Logo
-

Byte Open Security

(ByteOS Network)

Log In

Sign Up

ByteOS

Security
Vulnerability Details
Registries
Custom Views
Weaknesses
Attack Patterns
Filters & Tools
Vulnerability Details :

CVE-2026-39535

Summary
Assigner-Patchstack
Assigner Org ID-21595511-bba5-4825-b968-b78d1f9984a3
Published At-08 Apr, 2026 | 08:30
Updated At-13 Apr, 2026 | 19:38
Rejected At-
Credits

WordPress Display Eventbrite Events plugin <= 6.5.6 - Broken Access Control vulnerability

Missing Authorization vulnerability in fullworks Display Eventbrite Events widget-for-eventbrite-api allows Exploiting Incorrectly Configured Access Control Security Levels.This issue affects Display Eventbrite Events: from n/a through <= 6.5.6.

Vendors
-
Not available
Products
-
Metrics (CVSS)
VersionBase scoreBase severityVector
Weaknesses
Attack Patterns
Solution/Workaround
References
HyperlinkResource Type
EPSS History
Score
Latest Score
-
N/A
No data available for selected date range
Percentile
Latest Percentile
-
N/A
No data available for selected date range
Stakeholder-Specific Vulnerability Categorization (SSVC)
▼Common Vulnerabilities and Exposures (CVE)
cve.org
Assigner:Patchstack
Assigner Org ID:21595511-bba5-4825-b968-b78d1f9984a3
Published At:08 Apr, 2026 | 08:30
Updated At:13 Apr, 2026 | 19:38
Rejected At:
▼CVE Numbering Authority (CNA)
WordPress Display Eventbrite Events plugin <= 6.5.6 - Broken Access Control vulnerability

Missing Authorization vulnerability in fullworks Display Eventbrite Events widget-for-eventbrite-api allows Exploiting Incorrectly Configured Access Control Security Levels.This issue affects Display Eventbrite Events: from n/a through <= 6.5.6.

Affected Products
Vendor
fullworks
Product
Display Eventbrite Events
Collection URL
https://wordpress.org/plugins
Package Name
widget-for-eventbrite-api
Default Status
unaffected
Versions
Affected
  • From 0 through 6.5.6 (custom)
    • -> unaffectedfrom6.5.7
Problem Types
TypeCWE IDDescription
CWECWE-862Missing Authorization
Type: CWE
CWE ID: CWE-862
Description: Missing Authorization
Metrics
VersionBase scoreBase severityVector
Metrics Other Info
Impacts
CAPEC IDDescription
CAPEC-180Exploiting Incorrectly Configured Access Control Security Levels
CAPEC ID: CAPEC-180
Description: Exploiting Incorrectly Configured Access Control Security Levels
Solutions

Configurations

Workarounds

Exploits

Credits

finder
Bao - BlueRock | Patchstack Bug Bounty Program
Timeline
EventDate
Replaced By

Rejected Reason

References
HyperlinkResource
https://patchstack.com/database/Wordpress/Plugin/widget-for-eventbrite-api/vulnerability/wordpress-display-eventbrite-events-plugin-6-5-6-broken-access-control-vulnerability?_s_id=cve
vdb-entry
Hyperlink: https://patchstack.com/database/Wordpress/Plugin/widget-for-eventbrite-api/vulnerability/wordpress-display-eventbrite-events-plugin-6-5-6-broken-access-control-vulnerability?_s_id=cve
Resource:
vdb-entry
▼Authorized Data Publishers (ADP)
CISA ADP Vulnrichment
Affected Products
Metrics
VersionBase scoreBase severityVector
3.15.3MEDIUM
CVSS:3.1/AV:N/AC:L/PR:N/UI:N/S:U/C:N/I:L/A:N
Version: 3.1
Base score: 5.3
Base severity: MEDIUM
Vector:
CVSS:3.1/AV:N/AC:L/PR:N/UI:N/S:U/C:N/I:L/A:N
Metrics Other Info
Impacts
CAPEC IDDescription
Solutions

Configurations

Workarounds

Exploits

Credits

Timeline
EventDate
Replaced By

Rejected Reason

References
HyperlinkResource
Information is not available yet
▼National Vulnerability Database (NVD)
nvd.nist.gov
Source:audit@patchstack.com
Published At:08 Apr, 2026 | 09:16
Updated At:13 Apr, 2026 | 19:16

Missing Authorization vulnerability in fullworks Display Eventbrite Events widget-for-eventbrite-api allows Exploiting Incorrectly Configured Access Control Security Levels.This issue affects Display Eventbrite Events: from n/a through <= 6.5.6.

CISA Catalog
Date AddedDue DateVulnerability NameRequired Action
N/A
Date Added: N/A
Due Date: N/A
Vulnerability Name: N/A
Required Action: N/A
Metrics
TypeVersionBase scoreBase severityVector
Secondary3.15.3MEDIUM
CVSS:3.1/AV:N/AC:L/PR:N/UI:N/S:U/C:N/I:L/A:N
Type: Secondary
Version: 3.1
Base score: 5.3
Base severity: MEDIUM
Vector:
CVSS:3.1/AV:N/AC:L/PR:N/UI:N/S:U/C:N/I:L/A:N
CPE Matches

Weaknesses
CWE IDTypeSource
CWE-862Secondaryaudit@patchstack.com
CWE ID: CWE-862
Type: Secondary
Source: audit@patchstack.com
Evaluator Description

Evaluator Impact

Evaluator Solution

Vendor Statements

References
HyperlinkSourceResource
https://patchstack.com/database/Wordpress/Plugin/widget-for-eventbrite-api/vulnerability/wordpress-display-eventbrite-events-plugin-6-5-6-broken-access-control-vulnerability?_s_id=cveaudit@patchstack.com
N/A
Hyperlink: https://patchstack.com/database/Wordpress/Plugin/widget-for-eventbrite-api/vulnerability/wordpress-display-eventbrite-events-plugin-6-5-6-broken-access-control-vulnerability?_s_id=cve
Source: audit@patchstack.com
Resource: N/A

Change History

0
Information is not available yet

Similar CVEs

655Records found

CVE-2022-4974
Matching Score-6
Assigner-Wordfence
ShareView Details
Matching Score-6
Assigner-Wordfence
CVSS Score-6.3||MEDIUM
EPSS-0.21% / 42.91%
||
7 Day CHG~0.00%
Published-16 Oct, 2024 | 06:43
Updated-15 Apr, 2026 | 00:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Freemius SDK <= 2.4.2 - Missing Authorization Checks

The Freemius SDK, as used by hundreds of WordPress plugin and theme developers, was vulnerable to Cross-Site Request Forgery and Information disclosure due to missing capability checks and nonce protection on the _get_debug_log, _get_db_option, and the _set_db_option functions in versions up to, and including 2.4.2. Any WordPress plugin or theme running a version of Freemius less than 2.4.3 is vulnerable.

Action-Not Available
Vendor-pasyukdavidandersonwpchillmohsinofflinevincoitjanwylmohammedrezqjcodexversacompdiviframeworkwpvibeslistplustickerawpsaadgalooverproteusthemestripettodangub86mantrabrainpowerfulwpwebmuehlecloudspongeblackandwhitedigitaltauhidpromasterblocksbfintalivanchernyakovfrostbournboriscolombier/cmbibby/bestpluginswordpressnitin247creativethemeshqkaizencoderskartikparmartprintyedisonavehumblethemesdovypavidthemes/paulio21patrickgarmanibenicbeeneebchillichallicebbiwphrmanagerekanathjburleigh1uriahs-victorfsruslanmcurlyggriessermojofywpblockypagewpjolielbisnerohqthemeroyalnavneetxyulexsakurapixeldjenhcodexonicsinterfacelabelementinvaderatakanozfoxmooncypressnorthpluginswareupfivgallerycreatorjurskiinfosatechthemeseidudoco2okoceanwpwpgeniuzcommercepunditelliotvslostboy7sslatlasdejanmarkovicggeddesmartwpresskhothemesblocksparesovstackseezeelinekaldgwyermatstarswpscriptsdashlabsltdequalizedigitalbpluginsgloriousthemesw3scloudnasirahmedwiserstepsejslondon/melapressjavmahmulticollabcodesavorywpdeliciousmajickmdedevdotsdaigo75wpeka-clubedgegallerypluginsyntacticsnpluginscodeieswpbitsmoomooagencyhalmatahmed17wpdeverimtiazrayhanattestgreenjaymediacadudecastroalvespeterschulznlsindyakinsergeisurbmaninjalibspluginandplaymodulemastersrisethemeprotectyouruploadswpconedevzeethemecoderpresssslzensebettoddhalfpennymarviorochasonalsinha21vohotv/webba-agencystaxwpvernaltheafricanbossactuaryzaskmihail-barinovoloyede-jamiuldninjas/cloudlivingstarfishwpmnelson4intoxstudiostreamweaselsdipcodevinod-dalviprasadkirpekarlynn999getsparrowthemekraftmajick/pmbaldhathemelocationultradevspootlepressanfrageformulardotrexsvovafwp-makingpenguininitiativeshiddenpearlsolezhyk5patrickposnerzerozendesignstylingwebbenrenaudbodwpmagicsethereumicoiomaurolopes/flexithemeswpmunichtherealwebdisruptanasbinmukimalex-yelkoudalbenmoreassyntalexmosskenanfalloninputwpstevejburgematthias-reuteroceaskairamumarym1985koen12344wordplusrafacarvalhidowupowplegalpagesjanthielemanntribalnerdcleverpluginsweconnectcodepagebuildersandwichproperfractionrichard-bboltonstudiostheafricanboss/kartikparmar/pippozanardomeowcrewmaciejbak85jwebsolsj_oxplodedthemesdamian-gorajamesparkninjadanielisersalttechnomaltathemesdivisumostevehentywpkubewpmoosekylegilmanaharonyanmberdingwptbmattpramschufertonyzeolisjavedtranzlyivacylitonice13samdaniakdevsblockmeistermarcqueraltsebet/wpsoulthijziebilaltasdanielealessandraskymindsslidedeckkartechifywptravelengineaguilerasoftmte90jetixwpvanyukovspartacskshaikatwpeventpartners/samuelsilvaptpremmerceandyabelowdarelljkohlbachclickervolttakanakuipopeatingrebelcodelukeseagereedeefullworkssmgteambrandonfirelivemeshwpdiveusmanaliqureshithemeythemesirkanupmbaldha/badhonrockskkikuchi1220bouncingsproutinvisnetanssilaitiladam6plwebheadllcwgaugegowebsmartywpt00lsgiladtakoniwpengineessekiaprinceahmedwoodyhaydaybycrikmeepluginsfoopluginsmikebelsmuhammad-rehmansorsawojaydeep-nimavatglowlogixmaartenbelmansdanish-alironena100gkher/dreamfoxbrightvesseldevthemestyalleythemesalekvjohnc1979xjohnykcliffpaulickpassionatebrainsmunirkamalsetkawoopopsshelob9maxsdesignggwiczivan_paulinmhmrajibwpcohort/bavokoservicesdaniyalahmedkfrenifyalphabposervicembrown24deothemestropicalistalimbcodedvizheniawhiteshadowgfiremh3technologiestobias_conradcromer12cyberhobomikewire_rocksolidthinleekmilukove/closemarketing/shawoninfokitthemesthecodechimemilmorrankbearshamim51shabtisaadiqbalultimateblockskrspwalkerwpswitcorpwordpresschefunitecmsclosetechnologyinteractivegeomapsankitmaruannastaaiksstudiomilukovewpcohortseancarricosangaranjwindtobias_conrad/pagup9brada6buttonizerpootlepress/plugins360kaggdesignmvvapps/fastaf/scrollsequence5starpluginsdrosendosnazzythemesprelcchetmacrafalosinskibandidojosevegainfornwebwpdevpowersnicheaddonsBdThemesRoyal Elementor AddonsThe Events Calendar (StellarWP)WPWeb EliteThemeisle
Product-annasta Filters for WooCommerceBattle Suit for DiviBetter Robots.txt – AI-Ready Crawl Control & Bot GovernanceStyler Mate for Contact Form 7eaSYNC Booking – Hotels, Restaurants & Car RentalsWidget Detector for ElementorTickera – Sell Tickets & Manage EventsBlock Slider – Responsive Image Slider, Video Slider & Post SliderGloriousThemes Starter SitesGateway for PayLate on WooCommerceUltimate Post Kit Addons for ElementorDivi Content RestrictorLivemesh Addons for Beaver BuilderWidgets on Pages and PostsEvent Tickets and RegistrationWP Page TemplatesAutoSave NetAWCA – The Great Analytics Insights for Your eStoreWebinarIgnition – Live, Automated & Evergreen Webinars for WooCommerceInsert or Embed Articulate Content into WordPressForm Vibes – Database Manager for FormsQuick Contact FormLocal Delivery Drivers for WooCommerceAddon Elements for Elementor (formerly Elementor Addon Elements)Media Cloud for Bunny CDN, Amazon S3, Cloudflare R2, Google Cloud Storage, DigitalOcean and moreMenu Item SchedulerExpire tagsAdd Pinterest conversion tags for Pinterest Ads + Site verificationGA4WP – Analytics Dashboard for the WebsiteHM Multiple RolesWP Search FilterPlace Order Without Payment for WooCommerceBookPress – For Book AuthorsMusic Player for Elementor – Audio Player & Podcast PlayerPost Form – Registration Form – Profile Form for User Profiles – Frontend Content Forms for User Submissions (UGC)Bulk Attachment DownloadWordPress Dev Powers – ACF Color Coded Field Types PluginPost Carousel DiviWP Google Street View (with 360° virtual tour) & Google maps + Local SEOAutomatic Internal Links for SEO by PagupEasy Post Views CountAdvanced Page Visit Counter – Most Wanted Analytics Plugin for WordPressWordPress Gallery Plugin – Edge Photo GalleryBulk WooCommerce Category CreatorBooking Addon for WooCommerceEasy PrayerUkrposhtaPremmerce Variation Swatches for WooCommerceThe Events CalendarTK Google Fonts GDPR CompliantGuest posting / Frontend Posting / Front Editor – WP Front User SubmitDuplicate Variations for WoocommerceCF7 Constant Contact Fields MappingGeo MashupReplyable – Subscribe to Comments and Reply by EmailWP Photo EffectsMenu Image, Icons made easyAwesome SSLFiboSearch – Ajax Search for WooCommerceProduct Image Watermark for WooBetter SharingPremmerceRT Easy Builder – Advanced addons for ElementorAll-in-One Video GalleryTinyMCE AnnotateKVoucherWP fail2ban – Advanced SecurityDa ReactionsPayment Gateway for PayFabricNotification Bar, Announcement and Cookie Notice WordPress Plugin – FooBarNotifSMS – SMS Notifications OTP & 2FA for WordPress & WooCommerceWP Easy Pay – Payment and Donation form Builder for SquareConversion de moneda WoocommerceCustomers Table for WooCommerce: View, Search, Bulk EditorSchema Plugin For Divi, Gutenberg & ShortcodesMaster Accordion ( Former WP Awesome FAQ Plugin )Masonry Gallery & Posts For Divi (WP Tools)Blocksy CompanionRoyal Addons for Elementor – Addons and Templates Kit for ElementorBlockSpare — News, Magazine and Blog Addons for (Gutenberg) Block EditorWP Get PersonalPost Slider and Post Carousel with Post Vertical Scrolling Widget – A Responsive Post SliderGet Better Reviews for WooCommerceInbound BrewSimple Feature Requests Free – User Feedback BoardAnfrageformular – Multi Step Drag & Drop Formular Builder – LeadgenerierungEqualize Digital Accessibility Checker – WCAG, ADA, EAA and Section 508 complianceWordPress Coupon Plugin for Bloggers and Marketers – WP OffersEasy Code SnippetsDeMomentSomTres AddressDeMomentSomTres Media Tools AutoMarket ExporterWP GratifyHQTheme ExtraSlideDeck: Responsive WordPress Slider PluginMulti Page Auto Advance for Gravity FormsWP BugBotDeals of the Day WooCommercebbResolutionsSmart Variations Images & Swatches for WooCommercePremmerce Wishlist for WooCommerceRevolution for ElementorEasy Social Feed – Social Photos Gallery and Post Feed for WordPressPayment Gateway Per Product for WooCommerceWP Notification BellHelpie FAQ — Accordion, Docs & Knowledge BaseFrontend group restriction for LearnDashWidgets for WooCommerce Products on ElementorNugget by Ingot: Easy, automated and native A/B testing for everyoneGreenshift – animation and page builder blocksSTEWoo – Super Transactional Emails for WooCommerceThe best plugin for restrict content, support all Custom Post Types and Elementor – Password ProtectedFlat Rate Shipping Method for WooCommerceSimple Sitemap – Create a Responsive HTML SitemapClickerVolt – Affiliate Links & Click Tracking for Performance MarketersWooCommerce Next Order CouponNEXUSCAPTCHA 4WP – Antispam CAPTCHA solution for WordPressWP Relevant AdsIks Menu – WordPress Category Accordion Menu & FAQsWP Data Access – App Builder for Tables, Forms, Charts, Maps & DashboardsMarijuana Age VerifyWooCommerce upcoming ProductsEvents Calendar RegistrationChoice Payment Gateway for WooCommerceFilr – Secure document libraryWOW Styler for CF7 – Visual Styler for Contact Form 7 FormsPage Builder Sandwich – Front End WordPress Page Builder PluginBetter Addons for ElementorCuisine PalaceSVG Flags – Beautiful Scalable Flags For All Countries!VidSEO – Video transcript embedding for WordPress & LLMRating-Widget: Star Review SystemCryptocurrency Product for WooCommerceNew User ApproveUnakitGo Fetch Jobs (for WP Job Manager)Pixel Manager for WooCommerce – Conversion Tracking, Google Ads, GA4, TikTok, Dynamic RemarketingAutomizy Gravity FormsRaCar Clear Cart for WooCommerceWP-HR Manager: The Human Resources Plugin for WordPressReally Simple Featured Video – Featured Video Support for Posts, Pages & WooCommerce ProductsWordPress Auto SEO Plugin – Upfiv SEO WizardCookie Banner for GDPR / CCPA – WPLP Cookie ConsentFunnelmentalsShipping Gateway Per Product for WooCommerceDeMomentSomTres Grid ArchiveLicense Manager for WooCommerceVit Website ReviewsLawPress – Law Firm Website ManagementSpeculorAquarella LiteJoli Table Of ContentsWP Travel Engine – Tour Booking Plugin – Tour Operator SoftwareReset Course Progress For LearnDashResponsive Social Slider WidgetNitek Carousel Slider Cool TransitionsNumber ChatStreamWeasels Twitch IntegrationTreePress – Easy Family Trees & Ancestor ProfilesEvents Addon for ElementorContact List – Online Staff Directory & Address BookProtect Uploads with Login – Protect Your UploadsFrontend Admin by DynamiAppsWholesale for WooCommerceFull Page Blog DesignerAgy – Age verification for WooCommerceEthereumICOFuse Social Floating SidebarMOBILOOK — Mobile View & Mobile‑Friendly TestServer InfoCategorify – WordPress Media Library Category & File ManagerWUPO Group Attributes for WooCommerceLMS Plugin – eLearning, Online Courses by AttestMixed Media Gallery BlocksWordPress Slider Block GutensliderBlog Sidebar WidgetOcean ExtraNicheTable – Responsive Comparison Table BlockGlossaryConeBlog – Elementor Blog WidgetsXT Floating Cart for WooCommerceAEH Speed Optimization: Browser Cache, Optimized Minify, Lazy Loading & Image OptimizationUnder ConstructionElationAll in One Invite CodesLittleBot InvoicesUltra Elementor AddonsCustom Registration and Custom Login Forms with New RecaptchaMedia Library File DownloadSecure IP LoginsDomain Mapping System | Create Microsites with Multiple Alias Domains (multisite optional)Team Members – A WordPress Team Plugin with Gallery, Grid, Carousel, Slider, Table, List, and MoreClean Social IconsCoupon Affiliates – Affiliate Plugin for WooCommerceCountry Based Payments for WooCommerceFooter Plugin for DiviImage Carousel For DiviAge Verification Screen for WooCommerceDelivery for WooCommercePrice Bands for WooCommercePootle Pagebuilder – WordPress Page builderSEO Audit – WP Site AuditorSocial Gallery LiteContact Form 7 – Capsule CRM – IntegrationEverseCustom Login Page CustomizerRun time Image resizingBookit — Booking & Appointment CalendarFive-Star Ratings ShortcodeWordPress Everse Starter Sites – Elementor TemplatesSurveyFunnel – Survey Plugin for WordPressGutenberg Blocks – ACF Blocks SuiteWP Disable SitemapPro Broken Links MaintainerCustom WooCommerce Checkout Fields EditorAdd Tiktok Pixel for Tiktok ads (+Woocommerce)Security SafeFeedpress Generator – External RSS Frontend CustomizerModern Designs for Gravity FormsACF for WooCommerce ProductFile Manager for Google Drive – Integrate Google DriveAirpressDynamic Pricing and Discount Rules for WooCommerceBetter Messages – Integration for WC Vendors MarketplaceLightbox & Modal Popup WordPress Plugin – FooBoxDancePress (TRWA)SKT Templates – 100% Free Templates for Elementor & GutenbergAdvanced Classifieds & Directory ProListPlus – Unlimited Listing DirectoryUltimate Widgets LightPanorama – 360 Virtual Tour, Panoramic image viewer and MoreUltimeterQyrr – simply and modern QR-Code creationChange Price Title for WooCommerceCheckout with Cash App on EDDSV Tracking ManagerPodcast Box – Best Podcasting Plugin for WordPressElements for LifterLMSPassster – Password Protect Pages and ContentVillarAds.txt & App-ads.txt Manager for WordPressEasy Smooth Scroll Links – Smooth Scrolling AnchorLocalSEOMapWordPress form builder plugin for contact forms, surveys and quizzes – TripettoBlock, Suspend, Report for BuddyPressAdd Twitter Pixel for Twitter adsPremmerce Multi-currency for WoocommerceXT Quick View for WooCommercePrimary Addon for ElementorClimateClick: Climate Action for allFocus on Reviews for WooCommerceFeatured Images in RSS for Mailchimp & MoreSEO BoosterPremmerce Product Filter for WooCommerceBook BuyBack PricesWPGSI: Spreadsheet IntegrationSSL Atlas – Free SSL Certificate & HTTPS Redirect for WordPressWP Group PromoterFast WordPressPost Snippets – Custom WordPress Code Snippets CustomizerImage Alt Text Manager – Bulk & Dynamic Alt Tags For image SEO Optimization + AIActivity Log For MainWPHasiumBlocked in China | Check if your site is available in the Chinese mainlandElastaFeatured Products First for WooCommerce – A Extension of WooCommerce (WooCommerce Addon Plugin)Display Eventbrite EventsWP Affiliate DisclosureRestaurant & Cafe Addon for ElementorTeam Collaboration & Content Workflow Plugin for WordPress Editorial Teams – MulticollabWordPress Animation Plugin – Animated EverythingWP Encryption – One Click Free SSL Certificate & SSL / HTTPS Redirect, Security & SSL ScanContact Form 7 Multi-Step FormsWoocommerce Customer Reviews with Artificial Intelligence analyzis, with IBM Watson Tone AnalyzerPower Ups for ElementorWP Lead StreamVideopackWordPress Translation plugin for Post, Pages & WooCommerce products. Tranzly IO AI DeepL automatic WordPress Translator.Auto SEO META keywords (META tags keywords) optimization + WooCommerceBulk Edit Coupons for WooCommerce – WP Sheet EditorWooCommerce PayPlugRW Divi Unite GalleryWP Tools Divi Product CarouselQuick Affiliate StorePremmerce Permalink Manager for WooCommercePremmerce WooCommerce Customers ManagerWP Sessions Time Monitoring Full AutomaticWP Dev Powers – Display Screen Dimensions to Admin PluginAbeta Link PunchOutScrollsequence – Cinematic Scroll Image Animation PluginPremmerce Redirect ManagerYT Player – Embed and Customize Video PlayersPremmerce Wholesale Pricing for WooCommerceDelete Duplicate Postskk Star Ratings – Rate Post & Collect User FeedbacksDelete Posts automaticallyDrip Feed Content Extended for LearndashMaster Blocks – Gutenberg Site BuilderStation Pro – Advanced Audio Streaming & Player for WordPressWordPress SEO ChecklistOverlay Image Divi ModuleAnt Admin Notices for TeamAmelaSuper Video player – Fully Customizable Video Player with PlaylistWP Conference ScheduleEasy Math Captcha for CF7OpenseaXT Ajax Add To Cart for WooCommerceTiered Pricing Table for WooCommerceBulk Auto Image Alt Text (Alt tag, Alt attribute) optimizer (image SEO)Code ManagerWidget for Contact form 7StoreCustomizer – A plugin to Customize all WooCommerce PagesPopOverXYZ – Show Light Weight Beautiful Tool Tips On Any TextProduct Author for WooCommerceMaster Addons For Elementor – Widgets, Extensions, Theme Builder, Popup Builder & Template KitsPurusCaxton – Create Pro page layouts in GutenbergSalon Booking System – Free VersionWP School CalendarQuick Event ManagerWP Meta and Date RemoverTopNewsWp – Display Tikcer News, RSS Feed Widget and Many MoreWordPress Google TranslateAFI – The Easiest Integration PluginVO Store Locator – WP Store Locator PluginWS BootstrapPast Events ExtensionEasy Appointment Booking & Scheduling System – Webba Booking CalendarMultisite Robots.txt ManagerWPOptin – AI-Powered Top Bars, PopUps & Lead GenerationBlog Designer Pack – Blog, Post Grid, Post Slider, Post Carousel, Category Post, NewsShare This ImageRedirection for Contact Form 7Education Addon for ElementorShubanChat Button- Leads and Order over ChatAutomatic YouTube GalleryGenealogical Tree – Family Tree & Ancestry for WordPressWP Frontend ProfileGet feedback from visitors – WP Feedback Suite PluginInternal Link Juicer: SEO Auto Linker for WordPresswGauge – Free VersionViralikeSocialMark – Easy Watermark/Logo on Social Media Post Link Share PreviewImpexium Single Sign OnURL Shortify – Simple and Easy URL ShortenerTablesome Table – Contact Form DB – WPForms, CF7, Gravity, Forminator, FluentBlockMeister – Block Pattern BuilderFAQ Manager For Divi, Gutenberg Block & ShortcodeHooked Editable ContentPowerFolio – Portfolio & Image Gallery for ElementorRadio Player – Live Shoutcast, Icecast and Any Audio Stream PlayerPreloader for DiviError Log MonitorLive Drag and Drop Builder for Contact Form 7Better Messages – Live Chat, Chat Rooms, Real-Time Messaging & Private MessagesPremmerce User RolesWordPress Dev Powers – Element Selector jQuery Powers PluginDivi Gravity Forms (WP Tools)WordPress WooCommerce Sync for Google SheetPurosaWP MooseWP Activity LogComments Not Replied ToPledged Plugins Secure Gateway for Authorize.net and WooCommerceWP Table Builder – Drag & Drop Table BuilderAdvanced Database ReplacerEthPress – Web3 LoginTarot Card OracleGFireM Action AfterNokkeChange Prices with Time for WooCommerceSnazzyAdmin WP Admin ThemeModern Addons for Elementor Page BuilderHuCommerce | Magyar kiegészítések WooCommerce webáruházakhozSend Prebuilt EmailsAlley Business ToolkitProduct Attachment for WooCommercejav's – WooCommerce and Trello integration WooTrelloOrder and Inventory Manager for WooCommerceWalker CorePremmerce Product Search for WooCommerceSync eCommerce NEOUltimate Divi Modules Suite – Divi Sumo LiteWP Books Gallery – Build Stunning Book Showcases & Libraries in MinutesZip Code RedirectSurbma | GDPR Proof Cookie Consent & Notice BarProduct Options and Price Calculation Formulas for WooCommerce – Uni CPOProduct Customer List for WooCommerceStop Contact Form 7 Spam & WPForms Spam – Free ProtectionEasy Newsletter SignupsRest Routes – Custom Endpoints for WordPress REST APIBulk Edit Categories and Tags – Create Thousands Quickly on the EditorCP Simple NewsletterMeridiaSimple Social Page Widget & ShortcodeAidWP – Donation & Payment Forms (Stripe Powered)Multipurpose Gutenberg BlockBulk Edit Posts and Products in SpreadsheetWP Free SSLStreak CRM For Gmail For Contact Form 7 – WordPress PluginLivemesh SiteOrigin WidgetsRun Contests, Raffles, and Giveaways with ContestsWPFrontend Admin – Add and edit posts, pages, users and more all from the frontendCourt Reservation – Manage Your Court Bookings OnlineWordPress Directory Plugin For Business Listings – WP Local PlusEnhanced Ecommerce Google Analytics for WooCommerceKnowledge Base documentation & wiki plugin – BasePress DocsAtlas – Knowledge BaseWP Author BioUltimate Carousel For DiviWoocommerce Customers Order HistoryStore Toolkit – WooCommerce Extensions, Quick Enhancements & Handy ToolsBrandAny Popup – Popup Forms, Optins & AdsAdvanced Menu Manager Pro – Built for Content-heavy WordPress Sites to Add, Filter, Lock, and Edit Menus EasilySticky add to cart for WooWP EmailyEU VAT Assistant for WooCommerceLittleBot ACH for Stripe + PlaidWPMailer – The best mail builder, No More Core for your emails support Elementor, CF7 forms etc…TwentyFourth WP ScraperSocial KitButtonizer – Floating Menus, Sticky Buttons, & Popup BuilderFast Checkout for WooCommerceBanner Management, Product Slider, Product Carousel for WooCommerceBlockyPage – Gutenberg Based Page BuilderEthereum WalletPage Builder for Gutenberg – StarterBlocksGFireM Advance SearchRadio Station by netmix® – Manage and play your Show Schedule in WordPress!JDs PortfolioContent Aware Sidebars – Fastest Widget Area PluginCartPops – High Converting Add To Cart Popup For WooCommerceBuilder for WooCommerce product reviews shortcodes – ReviewShortQuick Paypal PaymentsOne Click LoginRestrict – membership, site, content and user access restrictions for WordPressDrop Shadow BoxesNicheBaseYatri ToolsBAVOKO SEO Tools – All-in-One WordPress SEOPremmerce SEO for WooCommerceRevivePress – Keep your Old Content EvergreenCartoon UrlBlock Styler For Gravity FormsStrumenti Partita IVA per WoocommerceSheetPress – Manage WordPress Meta data with Google SheetsProduct Size Charts Plugin for WooCommerceExtend Filter Products By Price WidgetEasy TikTok Feed – TikTok Video, Feed & Gallery PluginPost List Designer – Category Post, Recent Post, Post ListWP Coupons and Deals – Coupon Plugin For Affiliate MarketersGiveaways for woocommerceMass Pages/Posts CreatorUser Menus – Nav Menu VisibilityPage Builder Gutenberg Blocks – Kioken BlocksPrime Mover – Migrate WordPress Website & BackupsSSL Zen — SSL Certificate Installer & HTTPS RedirectsWPBITS Addons For Elementor Page BuilderLive TV Player – Worldwide Live TV Channels Player for WordPressDigital Goods (Checkout Field Editor) for WooCommerce CheckoutBaniSky Login RedirectWP Delicious – Recipe Plugin for Food Bloggers (formerly Delicious Recipes)Connect WooCommerce Shop to ERP/CRM, Verifactu and EU/VAT ComplianceWPVisitorInfo – Show Visitor Information & Conditional Data Based On That InformationStackable – Page Builder Gutenberg BlocksAvailability Datepicker – Booking Calendar for Contact Form 7 – Input WPGenerate Images (AI) – Magic Post ThumbnailGrid & Styler For Contact Form 7 And DiviYASR – Yet Another Star Rating Plugin for WordPressPay For Post with WooCommerceWP SPID ItaliaEther and ERC20 tokens WooCommerce Payment GatewayRestrict User Access – Ultimate Membership & Content ProtectionNinja Libs Amazon SESMailChimp ManagerGallery by FooGallerySQL Reporting Services – SSRS Plugin for WordPressSimple SponsorshipsWoo Admin Product NotesWC Shop Sync – Square Payment Gateway and Product Synchronization for WooCommerceProduct Carousel For WooCommerce – WoorouSellPostcode RedirectFullscreen MenuBulk Edit and Create User Profiles – WP Sheet EditorXT Variation Swatches for WooCommerceDocument Viewer – Embed Word, Excel, PowerPoint & PDFs InstantlyPrime Slider – Addons for ElementorPremmerce Brands for WooCommerceWP Adminify – White Label WordPress, Admin Menu Editor, Login CustomizerJoli FAQ SEO – WordPress FAQ PluginWP Tools Divi Blog CarouselUltimate Gutenberg – Custom Block TemplatesDivi Torque Lite – Divi Theme, Divi Builder & Extra ThemeCodeKit – Custom Codes EditorAPPExperts – Mobile App Builder for WordPress | WooCommerce to iOS and Android AppsFIT: Featured Image ToolkitConnected SermonsKikote – Location Picker at Checkout & Google Address AutoFill Plugin for WooCommerceGet Directions MapShared Files – Frontend File Upload Form & Secure File SharingWP Comment Cleaner – Delete All Comments, Disable Comments, Bulk Delete & Remove CommentsPinblocks — Gutenberg blocks with Pinterest widgetsGlorious Services & SupportBuddyPress WooCommerce My Account Integration. Create WooCommerce Member PagesWP Mobile Menu – The Mobile-Friendly Responsive MenuWordPress Reviews by ReviewPressAdd Linkedin insight tags for Linkedin adsConsultPress LiteWP Required Taxonomies – Categories and Tags MandatoryA no-code page builder for beautiful performance-based contentUltimate Bulk SEO Noindex Nofollow – Speed up Penalty Recovery Ultimate SEO BoosterHide Shipping Method For WooCommerceShipping Method Display Style for WooCommerceLightbox – EverlightBox GalleryLogo Showcase – Responsive Logo Carousel, Logo Slider & Logo GridSV Proven ExpertDynific Addons for Elementor (formerly AnyWhere Elementor)Wadi SurveyRemove Add to Cart WooCommerceazw woocommerce file uploadsWp My Admin BarGuestofy – Restaurant Reservations Plugin, Room Planer, Reservation FormGFireM Fields3D Viewer – Display Interactive 3D ModelsFeedbackScout: The easiest way to collect, prioritise, manage and track customer feedback.Fraud Prevention For WooCommerce and EDDCryptocurrency Portfolio TrackerКнопка ЮMoneyTag Groups is the Advanced Way to Display Your Taxonomy TermsWP Munich Blocks – Gutenberg Blocks for WordPressStreamCast – Live Radio Streaming PlayerWP AutoMedicW3SCloud Contact Form 7 to Zoho CRMWP Event Partners – WordPress Plugin for Event and Conference ManagementFood Store – Online Food Delivery & PickupXT Points & Rewards for WooCommerceRocket Maintenance Mode & Coming Soon PageSpotlight Social Feeds – Block, Shortcode, and WidgetForceFieldForms to Zapier, Integromat, IFTTT, Workato, Automate.io, elastic.io, Built.io, APIANT, WebhookPrint My Blog – Print, PDF, & eBook Converter WordPress PluginRecurWP – WordPress Recurly Payment GatewayLimb Gallery | Create Beautiful Image & Video GalleriesOut of stock display for woocommercePersistent LoginAnnouncement & Notification Banner – BulletinLearnMoreIvory Search – WordPress Search PluginImage Photo Gallery Final Tiles GridEasy Settings for LearnDashWP Radio – Worldwide Online Radio Stations Directory for WordPressBefore and After Product Images for WooCommerceScheduled Notification BarWoowGallerySTAX Header BuilderWP-Cron Status CheckerGo Viral – social share, social sharebar, social locker, social chat, open graph, reactions, share & view countersBulk Auto Image Title Attribute (Image Title tag) optimizer (Image SEO)Justified GalleryWPBakery Page Builder Addons by LivemeshEasy Zillow ReviewsTabs with Recommended Posts (Widget)WP SierraFront End PMWP Frontend Admin – Display WP Admin Pages in the FrontendEmail TrackerPerformance KitEmail Header FooterWP Post BlockSimple Giveaways – Grow your business, email lists and traffic with contestsCheckout with Zelle on WoocommerceThank You Page for WooCommerceMapGeo – Interactive Geo MapsPost to Google My Business (Google Business Profile)WP Link BioAdFoxly – Ad Manager, AdSense Ads & Ads.txtPoints Management System For Gamification, Ranks, Badges, and Loyalty Rewards Program – myCredKRSP Frontend File UploaderUltimate Blocks – 25+ Gutenberg Blocks for Block EditorStarfish Review Generation & Marketing for WordPressB2B Request a QuoteLivemesh Addons by ElementorWP Contact Slider – Contact Form Slider WidgetTK SmugMug Slideshow ShortcodeEmails Blacklist for Everest FormsCoinbase Commerce – Crypto Gateway for WooCommerceUnlimited Elements For ElementorWooCommerce Variation Swatches for ProductsWCC SEO Keyword ResearchRankBearGift Message for WooCommerceSouth Pole: Climate action nowWidgets on PagesContact Widgets For Elementor all the contact links you need in one placeSecurity Ninja – WordPress Security & FirewallProduct Country Restrictions for WooCommerce – Country CatalogsGallery PhotoBlocksWordPress Buffer – HYPESocial. Social Media Auto Post, Social Media Auto Publish and ScheduleFloating Social Share Icons and Social Share buttons – Next Previous Post Links – FLSparrow: Product Reviews and Ratings for WooCommerceLive Scores for SportsPressBroadcast LiteAffiliate Link Builder Plugin for Amazon Associates – Review EngineBulk Edit Products for WooCommerce – WP Sheet EditorDivi CollageEasy Age VerifyDisable Payment Methods based on cart conditions for WooCommerceDashy – Google Analytics advanced dashboardCheckout with Venmo on EDDWP Smart Export (Free)Better Messages – WCFM IntegrationAdvanced Custom Fields options import/exportTurbo WidgetsArendelleExtra Fees for WooCommerce
CWE ID-CWE-862
Missing Authorization
CVE-2025-31065
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-5.3||MEDIUM
EPSS-0.23% / 45.72%
||
7 Day CHG~0.00%
Published-16 May, 2025 | 15:45
Updated-19 May, 2025 | 13:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Rozario <= 1.4 - Broken Access Control Vulnerability

Missing Authorization vulnerability in themeton Rozario allows Exploiting Incorrectly Configured Access Control Security Levels. This issue affects Rozario: from n/a through 1.4.

Action-Not Available
Vendor-themeton
Product-Rozario
CWE ID-CWE-862
Missing Authorization
CVE-2026-5502
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-5.3||MEDIUM
EPSS-0.01% / 1.29%
||
7 Day CHG~0.00%
Published-17 Apr, 2026 | 03:36
Updated-17 Apr, 2026 | 14:28
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Tutor LMS <= 3.9.8 - Authenticated (Subscriber+) Arbitrary Course Content Manipulation via tutor_update_course_content_order

The Tutor LMS – eLearning and online course solution plugin for WordPress is vulnerable to unauthorized course content manipulation in versions up to and including 3.9.8. This is due to a missing authorization check in the tutor_update_course_content_order() function. The function only validates the nonce (CSRF protection) but does not verify whether the user has permission to manage course content. The can_user_manage() authorization check only executes when the 'content_parent' parameter is present in the request. When this parameter is omitted, the function proceeds directly to save_course_content_order() which manipulates the wp_posts table without any authorization validation. This makes it possible for authenticated attackers with subscriber-level access and above to detach all lessons from any topic, move lessons between topics, and modify the menu_order of course content, effectively allowing them to disrupt the structure of any course on the site.

Action-Not Available
Vendor-Themeum
Product-Tutor LMS – eLearning and online course solution
CWE ID-CWE-862
Missing Authorization
CVE-2024-56349
Matching Score-4
Assigner-JetBrains s.r.o.
ShareView Details
Matching Score-4
Assigner-JetBrains s.r.o.
CVSS Score-5.3||MEDIUM
EPSS-0.01% / 1.99%
||
7 Day CHG~0.00%
Published-20 Dec, 2024 | 14:11
Updated-02 Jan, 2025 | 18:51
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

In JetBrains TeamCity before 2024.12 improper access control allowed unauthorized users to modify build logs

Action-Not Available
Vendor-JetBrains s.r.o.
Product-teamcityTeamCity
CWE ID-CWE-862
Missing Authorization
CVE-2019-15723
Matching Score-4
Assigner-MITRE Corporation
ShareView Details
Matching Score-4
Assigner-MITRE Corporation
CVSS Score-5.3||MEDIUM
EPSS-0.24% / 47.44%
||
7 Day CHG~0.00%
Published-16 Sep, 2019 | 16:46
Updated-05 Aug, 2024 | 00:56
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

An issue was discovered in GitLab Community and Enterprise Edition 11.9.x and 11.10.x before 11.10.1. Merge requests created by email could be used to bypass push rules in certain situations.

Action-Not Available
Vendor-n/aGitLab Inc.
Product-gitlabn/a
CWE ID-CWE-862
Missing Authorization
CVE-2024-35174
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-5.3||MEDIUM
EPSS-0.15% / 36.25%
||
7 Day CHG~0.00%
Published-17 May, 2024 | 10:18
Updated-15 Apr, 2026 | 00:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Flo Forms plugin <= 1.0.42 - Broken Access Control vulnerability

Missing Authorization vulnerability in Flothemes Flo Forms.This issue affects Flo Forms: from n/a through 1.0.42.

Action-Not Available
Vendor-Flothemesflothemes
Product-Flo Formsflo_forms
CWE ID-CWE-862
Missing Authorization
CVE-2024-13520
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-5.3||MEDIUM
EPSS-0.23% / 46.17%
||
7 Day CHG~0.00%
Published-20 Feb, 2025 | 09:21
Updated-08 Apr, 2026 | 17:18
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Gift Cards (Gift Vouchers and Packages) (WooCommerce Supported) <= 4.4.9 - Missing Authorization to Unauthenticated Price, Date, and Note Updates

The Gift Cards (Gift Vouchers and Packages) (WooCommerce Supported) plugin for WordPress is vulnerable to unauthorized modification of data|loss of data due to a missing capability check on the 'update_voucher_price', 'update_voucher_date', 'update_voucher_note' functions in all versions up to, and including, 4.4.9. This makes it possible for unauthenticated attackers to update the value, expiration date, and user note for any gift voucher.

Action-Not Available
Vendor-codemenschencodemenschen
Product-gift_vouchersGift Cards (Gift Vouchers and Packages) (WooCommerce Supported)
CWE ID-CWE-862
Missing Authorization
CVE-2025-2821
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-5.3||MEDIUM
EPSS-0.35% / 57.42%
||
7 Day CHG~0.00%
Published-07 May, 2025 | 01:43
Updated-15 Apr, 2026 | 00:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Search Exclude <= 2.4.9 - Missing Authorization to Unauthenticated Plugin Settings Modification

The Search Exclude plugin for WordPress is vulnerable to unauthorized modification of data due to a missing capability check on the get_rest_permission function in all versions up to, and including, 2.4.9. This makes it possible for unauthenticated attackers to modify plugin settings, excluding content from search results.

Action-Not Available
Vendor-quadlayers
Product-Search Exclude
CWE ID-CWE-862
Missing Authorization
CVE-2019-15998
Matching Score-4
Assigner-Cisco Systems, Inc.
ShareView Details
Matching Score-4
Assigner-Cisco Systems, Inc.
CVSS Score-5.3||MEDIUM
EPSS-0.36% / 58.17%
||
7 Day CHG~0.00%
Published-26 Nov, 2019 | 03:41
Updated-19 Nov, 2024 | 18:51
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Cisco IOS XR Software NETCONF Over Secure Shell ACL Bypass Vulnerability

A vulnerability in the access-control logic of the NETCONF over Secure Shell (SSH) of Cisco IOS XR Software may allow connections despite an access control list (ACL) that is configured to deny access to the NETCONF over SSH of an affected device. The vulnerability is due to a missing check in the NETCONF over SSH access control list (ACL). An attacker could exploit this vulnerability by connecting to an affected device using NETCONF over SSH. A successful exploit could allow the attacker to connect to the device on the NETCONF port. Valid credentials are required to access the device. This vulnerability does not affect connections to the default SSH process on the device.

Action-Not Available
Vendor-Cisco Systems, Inc.
Product-asr_9904asr_9006asr_9912asr_9922asr_9010asr_9001ios_xrasr_9901Cisco IOS XR Software
CWE ID-CWE-284
Improper Access Control
CWE ID-CWE-862
Missing Authorization
CVE-2022-4943
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-7.5||HIGH
EPSS-0.34% / 56.70%
||
7 Day CHG~0.00%
Published-20 Oct, 2023 | 07:29
Updated-08 Apr, 2026 | 18:17
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
miniOrange's Google Authenticator <= 5.6.5 - Missing Authorization to Plugin Settings Change

The miniOrange's Google Authenticator plugin for WordPress is vulnerable to authorization bypass due to a missing capability check when changing plugin settings in versions up to, and including, 5.6.5. This makes it possible for unauthenticated attackers to change the plugin's settings.

Action-Not Available
Vendor-miniorangecyberlord92
Product-google_authenticatorminiOrange 2FA – Two-Factor Authentication for WordPress (SMS, Email & Google Authenticator)
CWE ID-CWE-862
Missing Authorization
CVE-2023-46637
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-5.3||MEDIUM
EPSS-0.18% / 39.12%
||
7 Day CHG~0.00%
Published-02 Jan, 2025 | 12:00
Updated-15 Apr, 2026 | 00:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Generate Dummy Posts plugin <= 1.0.0 - Broken Access Control vulnerability

Missing Authorization vulnerability in Saurav Sharma Generate Dummy Posts allows Exploiting Incorrectly Configured Access Control Security Levels.This issue affects Generate Dummy Posts: from n/a through 1.0.0.

Action-Not Available
Vendor-Saurav Sharma
Product-Generate Dummy Posts
CWE ID-CWE-862
Missing Authorization
CVE-2022-48491
Matching Score-4
Assigner-Huawei Technologies
ShareView Details
Matching Score-4
Assigner-Huawei Technologies
CVSS Score-5.3||MEDIUM
EPSS-0.09% / 25.28%
||
7 Day CHG+0.01%
Published-19 Jun, 2023 | 00:00
Updated-17 Dec, 2024 | 15:53
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

Vulnerability of missing authentication on certain HUAWEI phones.Successful exploitation of this vulnerability can lead to ads and other windows to display at any time.

Action-Not Available
Vendor-Huawei Technologies Co., Ltd.
Product-emuiHarmonyOSEMUI
CWE ID-CWE-862
Missing Authorization
CVE-2024-35685
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-5.3||MEDIUM
EPSS-0.21% / 42.90%
||
7 Day CHG~0.00%
Published-11 Jun, 2024 | 10:46
Updated-15 Apr, 2026 | 00:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Radcliffe 2 theme <= 2.0.17 - Broken Access Control vulnerability

Missing Authorization vulnerability in Anders Norén Radcliffe 2.This issue affects Radcliffe 2: from n/a through 2.0.17.

Action-Not Available
Vendor-Anders Norénanders_noren
Product-Radcliffe 2radcliffe_2
CWE ID-CWE-862
Missing Authorization
CVE-2022-47182
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-5.3||MEDIUM
EPSS-0.14% / 33.14%
||
7 Day CHG~0.00%
Published-13 Dec, 2024 | 14:22
Updated-15 Apr, 2026 | 00:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress APIExperts Square for WooCommerce plugin <= 4.4.1 - Broken Access Control

Missing Authorization vulnerability in Wpexpertsio APIExperts Square for WooCommerce allows Exploiting Incorrectly Configured Access Control Security Levels.This issue affects APIExperts Square for WooCommerce: from n/a through 4.4.1.

Action-Not Available
Vendor-Wpexpertsio
Product-APIExperts Square for WooCommerce
CWE ID-CWE-862
Missing Authorization
CVE-2024-12158
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-5.3||MEDIUM
EPSS-0.34% / 57.07%
||
7 Day CHG~0.00%
Published-07 Jan, 2025 | 04:22
Updated-15 Apr, 2026 | 00:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Popup – MailChimp, GetResponse and ActiveCampaign Intergrations <= 3.2.6 - Missing Authorization to Unauthenticated DB Table Truncation

The Popup – MailChimp, GetResponse and ActiveCampaign Intergrations plugin for WordPress is vulnerable to unauthorized loss of data due to a missing capability check on the 'upc_delete_db_data' AJAX action in all versions up to, and including, 3.2.6. This makes it possible for unauthenticated attackers to delete the DB data for the plugin.

Action-Not Available
Vendor-arrowplugins
Product-Popup – MailChimp, GetResponse and ActiveCampaign Intergrations
CWE ID-CWE-862
Missing Authorization
CVE-2022-4555
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-6.5||MEDIUM
EPSS-0.73% / 72.77%
||
7 Day CHG~0.00%
Published-16 Dec, 2022 | 13:54
Updated-08 Apr, 2026 | 18:17
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WP Shamsi <= 4.1.0 - Missing Authorization to Arbitrary Plugin Deactivation

The WP Shamsi plugin for WordPress is vulnerable to authorization bypass due to a missing capability check on the deactivate() function hooked via init() in versions up to, and including, 4.1.0. This makes it possible for unauthenticated attackers to deactivate arbitrary plugins on the site. This can be used to deactivate security plugins that aids in exploiting other vulnerabilities.

Action-Not Available
Vendor-wpvarwpvar
Product-wp_shamsiWP Shamsi – افزونه تاریخ شمسی و فارسی ساز وردپرس
CWE ID-CWE-862
Missing Authorization
CVE-2026-39663
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-5.3||MEDIUM
EPSS-0.04% / 10.85%
||
7 Day CHG+0.02%
Published-08 Apr, 2026 | 08:30
Updated-13 Apr, 2026 | 19:28
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress TrueBooker plugin <= 1.1.5 - Broken Access Control vulnerability

Missing Authorization vulnerability in themetechmount TrueBooker truebooker-appointment-booking allows Exploiting Incorrectly Configured Access Control Security Levels.This issue affects TrueBooker: from n/a through <= 1.1.5.

Action-Not Available
Vendor-themetechmount
Product-TrueBooker
CWE ID-CWE-862
Missing Authorization
CVE-2022-46846
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-5.3||MEDIUM
EPSS-0.15% / 35.41%
||
7 Day CHG~0.00%
Published-13 Dec, 2024 | 14:22
Updated-15 Apr, 2026 | 00:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Trending/Popular Post Slider and Widget plugin <= 1.5.7 - Broken Access Control vulnerability

Missing Authorization vulnerability in WP OnlineSupport, Essential Plugin Trending/Popular Post Slider and Widget allows Exploiting Incorrectly Configured Access Control Security Levels.This issue affects Trending/Popular Post Slider and Widget: from n/a through 1.5.7.

Action-Not Available
Vendor-WP OnlineSupport, Essential Plugin
Product-Trending/Popular Post Slider and Widget
CWE ID-CWE-862
Missing Authorization
CVE-2022-46845
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-5.3||MEDIUM
EPSS-0.08% / 24.41%
||
7 Day CHG~0.00%
Published-09 Dec, 2025 | 16:42
Updated-09 Dec, 2025 | 18:36
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Slider a SlidersPack plugin <= 2.0.2 - Broken Access Control vulnerability

Missing Authorization vulnerability in Essential Plugin Slider a SlidersPack allows Exploiting Incorrectly Configured Access Control Security Levels.This issue affects Slider a SlidersPack: from n/a before 2.3.

Action-Not Available
Vendor-Essential Plugin
Product-Slider a SlidersPack
CWE ID-CWE-862
Missing Authorization
CVE-2022-45070
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-5.3||MEDIUM
EPSS-0.22% / 44.34%
||
7 Day CHG~0.00%
Published-17 May, 2024 | 06:27
Updated-15 Apr, 2026 | 00:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Conditional Checkout Fields for WooCommerce plugin <= 1.2.3 - Broken Authentication vulnerability

Missing Authorization vulnerability in FmeAddons Conditional Checkout Fields for WooCommerce.This issue affects Conditional Checkout Fields for WooCommerce: from n/a through 1.2.3.

Action-Not Available
Vendor-FmeAddons
Product-Conditional Checkout Fields for WooCommerce
CWE ID-CWE-862
Missing Authorization
CVE-2025-26867
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-5.3||MEDIUM
EPSS-0.23% / 45.72%
||
7 Day CHG~0.00%
Published-19 May, 2025 | 16:48
Updated-21 May, 2025 | 20:25
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Bulk theme <= 1.0.11 - Broken Access Control vulnerability

Missing Authorization vulnerability in Themes4WP Bulk allows Accessing Functionality Not Properly Constrained by ACLs.This issue affects Bulk: from n/a through 1.0.11.

Action-Not Available
Vendor-Themes4WP
Product-Bulk
CWE ID-CWE-862
Missing Authorization
CVE-2026-39675
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-5.3||MEDIUM
EPSS-0.04% / 10.85%
||
7 Day CHG+0.02%
Published-08 Apr, 2026 | 08:30
Updated-13 Apr, 2026 | 19:25
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Court Reservation plugin <= 1.10.11 - Broken Access Control vulnerability

Missing Authorization vulnerability in webmuehle Court Reservation court-reservation allows Exploiting Incorrectly Configured Access Control Security Levels.This issue affects Court Reservation: from n/a through <= 1.10.11.

Action-Not Available
Vendor-webmuehle
Product-Court Reservation
CWE ID-CWE-862
Missing Authorization
CVE-2022-44578
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-5.3||MEDIUM
EPSS-0.15% / 35.41%
||
7 Day CHG~0.00%
Published-13 Dec, 2024 | 14:23
Updated-15 Apr, 2026 | 00:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Owl Carousel plugin <= 0.5.3 - Broken Access Control vulnerability

Missing Authorization vulnerability in Pierre JEHAN Owl Carousel allows Exploiting Incorrectly Configured Access Control Security Levels.This issue affects Owl Carousel: from n/a through 0.5.3.

Action-Not Available
Vendor-Pierre JEHAN
Product-Owl Carousel
CWE ID-CWE-862
Missing Authorization
CVE-2022-45389
Matching Score-4
Assigner-Jenkins Project
ShareView Details
Matching Score-4
Assigner-Jenkins Project
CVSS Score-5.3||MEDIUM
EPSS-1.96% / 83.52%
||
7 Day CHG~0.00%
Published-15 Nov, 2022 | 00:00
Updated-30 Apr, 2025 | 18:15
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

A missing permission check in Jenkins XP-Dev Plugin 1.0 and earlier allows unauthenticated attackers to trigger builds of jobs corresponding to an attacker-specified repository.

Action-Not Available
Vendor-Jenkins
Product-xp-devJenkins XP-Dev Plugin
CWE ID-CWE-862
Missing Authorization
CVE-2025-2568
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-5.3||MEDIUM
EPSS-0.62% / 70.01%
||
7 Day CHG~0.00%
Published-08 Apr, 2025 | 11:11
Updated-15 Apr, 2026 | 00:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Vayu Blocks – Gutenberg Blocks for WordPress & WooCommerce 1.0.4 - 1.2.1 - Missing Authorization to Unauthenticated Limited Arbitrary Options Update

The Vayu Blocks – Gutenberg Blocks for WordPress & WooCommerce plugin for WordPress is vulnerable to unauthorized access and modification of data due to missing capability checks on the 'vayu_blocks_get_toggle_switch_values_callback' and 'vayu_blocks_save_toggle_switch_callback' function in versions 1.0.4 to 1.2.1. This makes it possible for unauthenticated attackers to read plugin options and update any option with a key name ending in '_value'.

Action-Not Available
Vendor-themehunk
Product-Vayu Blocks – Gutenberg Blocks for WordPress & WooCommerce
CWE ID-CWE-862
Missing Authorization
CVE-2022-43421
Matching Score-4
Assigner-Jenkins Project
ShareView Details
Matching Score-4
Assigner-Jenkins Project
CVSS Score-5.3||MEDIUM
EPSS-3.04% / 86.70%
||
7 Day CHG~0.00%
Published-19 Oct, 2022 | 00:00
Updated-08 May, 2025 | 19:15
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

A missing permission check in Jenkins Tuleap Git Branch Source Plugin 3.2.4 and earlier allows unauthenticated attackers to trigger Tuleap projects whose configured repository matches the attacker-specified value.

Action-Not Available
Vendor-Jenkins
Product-tuleap_git_branch_sourceJenkins Tuleap Git Branch Source Plugin
CWE ID-CWE-862
Missing Authorization
CVE-2022-4169
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-6.5||MEDIUM
EPSS-0.54% / 67.68%
||
7 Day CHG~0.00%
Published-28 Nov, 2022 | 17:33
Updated-08 Apr, 2026 | 18:17
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Theme and plugin translation for Polylang <= 3.2.16 - Missing Authorization

The Theme and plugin translation for Polylang is vulnerable to authorization bypass in versions up to, and including, 3.2.16 due to missing capability checks in the process_polylang_theme_translation_wp_loaded() function. This makes it possible for unauthenticated attackers to update plugin and theme translation settings and to import translation strings.

Action-Not Available
Vendor-theme_and_plugin_translation_for_polylang_projectmarcinkazmierski
Product-theme_and_plugin_translation_for_polylangTheme and plugin translation for Polylang (TTfP)
CWE ID-CWE-862
Missing Authorization
CVE-2026-4281
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-5.3||MEDIUM
EPSS-0.25% / 48.19%
||
7 Day CHG~0.00%
Published-26 Mar, 2026 | 03:37
Updated-08 Apr, 2026 | 17:13
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
FormLift for Infusionsoft Web Forms <= 7.5.21 - Missing Authorization to Unauthenticated Infusionsoft Connection Hijack via OAuth Connection Flow

The FormLift for Infusionsoft Web Forms plugin for WordPress is vulnerable to Missing Authorization in all versions up to, and including, 7.5.21. This is due to missing capability checks on the connect() and listen_for_tokens() methods of the FormLift_Infusionsoft_Manager class, both of which are hooked to 'plugins_loaded' and execute on every page load. The connect() function generates an OAuth connection password and leaks it in the redirect Location header without verifying the requesting user is authenticated or authorized. The listen_for_tokens() function only validates the temporary password but performs no user authentication before calling update_option() to save attacker-controlled OAuth tokens and app domain. This makes it possible for unauthenticated attackers to hijack the site's Infusionsoft connection by first triggering the OAuth flow to obtain the temporary password, then using that password to set arbitrary OAuth tokens and app domain via update_option(), effectively redirecting the plugin's API communication to an attacker-controlled server.

Action-Not Available
Vendor-trainingbusinesspros
Product-FormLift for Infusionsoft Web Forms
CWE ID-CWE-862
Missing Authorization
CVE-2023-49193
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-5.3||MEDIUM
EPSS-0.18% / 39.12%
||
7 Day CHG~0.00%
Published-09 Dec, 2024 | 11:30
Updated-15 Apr, 2026 | 00:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Grow Social plugin <= 1.30.0 - Broken Access Control vulnerability

Missing Authorization vulnerability in NerdPress Social Pug allows Exploiting Incorrectly Configured Access Control Security Levels.This issue affects Social Pug: from n/a through 1.30.0.

Action-Not Available
Vendor-NerdPressnerdpress
Product-Social Pugsocial_pug_wordpress
CWE ID-CWE-862
Missing Authorization
CVE-2023-47823
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-5.3||MEDIUM
EPSS-0.21% / 42.70%
||
7 Day CHG~0.00%
Published-09 Dec, 2024 | 11:30
Updated-15 Apr, 2026 | 00:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress FormCraft – Contact Form Builder for WordPress plugin <= 1.2.7 - Broken Access Control vulnerability

Missing Authorization vulnerability in nCrafts FormCraft allows Exploiting Incorrectly Configured Access Control Security Levels.This issue affects FormCraft: from n/a through 1.2.7.

Action-Not Available
Vendor-nCraftsncrafts
Product-FormCraftformcraft
CWE ID-CWE-862
Missing Authorization
CVE-2021-24978
Matching Score-4
Assigner-WPScan
ShareView Details
Matching Score-4
Assigner-WPScan
CVSS Score-5.3||MEDIUM
EPSS-0.14% / 34.69%
||
7 Day CHG~0.00%
Published-28 Mar, 2022 | 17:21
Updated-03 Aug, 2024 | 19:49
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
OSMapper <= 2.1.5 - Unauthenticated Arbitrary Post Deletion

The OSMapper WordPress plugin through 2.1.5 contains an AJAX action to delete a plugin related post type named 'map' and is registered with the wp_ajax_nopriv prefix, making it available to unauthenticated users. There is no authorisation, CSRF and checks in place to ensure that the post to delete is a map one. As a result, unauthenticated user can delete arbitrary posts from the blog

Action-Not Available
Vendor-b4afterUnknown
Product-osmapperOSMapper
CWE ID-CWE-862
Missing Authorization
CWE ID-CWE-352
Cross-Site Request Forgery (CSRF)
CVE-2023-46083
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-5.3||MEDIUM
EPSS-0.18% / 39.12%
||
7 Day CHG~0.00%
Published-02 Jan, 2025 | 11:59
Updated-15 Apr, 2026 | 00:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Kali Forms plugin <= 2.3.27 - Broken Access Control vulnerability

Missing Authorization vulnerability in Kali Forms Contact Form builder with drag & drop - Kali Forms allows Exploiting Incorrectly Configured Access Control Security Levels.This issue affects Contact Form builder with drag & drop - Kali Forms: from n/a through 2.3.27.

Action-Not Available
Vendor-Kali Forms
Product-Contact Form builder with drag & drop - Kali Forms
CWE ID-CWE-862
Missing Authorization
CVE-2026-5427
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-5.3||MEDIUM
EPSS-0.01% / 1.78%
||
7 Day CHG~0.00%
Published-17 Apr, 2026 | 03:36
Updated-17 Apr, 2026 | 18:48
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Kubio AI Page Builder <= 2.7.2 - Missing Authorization to Authenticated (Contributor+) Limited File Upload via Kubio Block Attributes

The Kubio plugin for WordPress is vulnerable to Arbitrary File Upload in versions up to and including 2.7.2. This is due to insufficient capability checks in the kubio_rest_pre_insert_import_assets() function, which is hooked to the rest_pre_insert_{post_type} filter for posts, pages, templates, and template parts. When a post is created or updated via the REST API, Kubio parses block attributes looking for URLs in the 'kubio' attribute namespace and automatically imports them via importRemoteFile() without verifying the user has the upload_files capability. This makes it possible for authenticated attackers with Contributor-level access and above to bypass WordPress's normal media upload restrictions and upload files fetched from external URLs to the media library, creating attachment posts in the database.

Action-Not Available
Vendor-extendthemes
Product-Kubio AI Page Builder
CWE ID-CWE-862
Missing Authorization
CVE-2026-39713
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-5.3||MEDIUM
EPSS-0.04% / 10.85%
||
7 Day CHG+0.02%
Published-08 Apr, 2026 | 08:30
Updated-13 Apr, 2026 | 19:16
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Mailercloud – Integrate webforms and synchronize website contacts plugin <= 1.0.7 - Broken Access Control vulnerability

Missing Authorization vulnerability in mailercloud Mailercloud &#8211; Integrate webforms and synchronize website contacts mailercloud-integrate-webforms-synchronize-contacts allows Exploiting Incorrectly Configured Access Control Security Levels.This issue affects Mailercloud &#8211; Integrate webforms and synchronize website contacts: from n/a through <= 1.0.7.

Action-Not Available
Vendor-mailercloud
Product-Mailercloud &#8211; Integrate webforms and synchronize website contacts
CWE ID-CWE-862
Missing Authorization
CVE-2026-39585
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-5.3||MEDIUM
EPSS-0.04% / 10.85%
||
7 Day CHG+0.02%
Published-08 Apr, 2026 | 08:30
Updated-13 Apr, 2026 | 19:36
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Booktics plugin <= 1.0.16 - Broken Access Control vulnerability

Missing Authorization vulnerability in Arraytics Booktics booktics allows Exploiting Incorrectly Configured Access Control Security Levels.This issue affects Booktics: from n/a through <= 1.0.16.

Action-Not Available
Vendor-Arraytics
Product-Booktics
CWE ID-CWE-862
Missing Authorization
CVE-2026-39669
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-5.3||MEDIUM
EPSS-0.04% / 10.85%
||
7 Day CHG+0.02%
Published-08 Apr, 2026 | 08:30
Updated-13 Apr, 2026 | 19:27
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress NitroPack plugin <= 1.19.3 - Broken Access Control vulnerability

Missing Authorization vulnerability in NitroPack NitroPack nitropack allows Exploiting Incorrectly Configured Access Control Security Levels.This issue affects NitroPack: from n/a through <= 1.19.3.

Action-Not Available
Vendor-NitroPack
Product-NitroPack
CWE ID-CWE-862
Missing Authorization
CVE-2026-39685
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-5.3||MEDIUM
EPSS-0.04% / 10.85%
||
7 Day CHG+0.02%
Published-08 Apr, 2026 | 08:30
Updated-13 Apr, 2026 | 19:25
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress The Moneytizer plugin <= 10.0.10 - Broken Access Control vulnerability

Missing Authorization vulnerability in lvaudore The Moneytizer the-moneytizer allows Exploiting Incorrectly Configured Access Control Security Levels.This issue affects The Moneytizer: from n/a through <= 10.0.10.

Action-Not Available
Vendor-lvaudore
Product-The Moneytizer
CWE ID-CWE-862
Missing Authorization
CVE-2026-39606
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-5.3||MEDIUM
EPSS-0.04% / 10.85%
||
7 Day CHG+0.02%
Published-08 Apr, 2026 | 08:30
Updated-13 Apr, 2026 | 19:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress BizReview plugin <= 1.5.13 - Broken Access Control vulnerability

Missing Authorization vulnerability in Foysal Imran BizReview bizreview allows Exploiting Incorrectly Configured Access Control Security Levels.This issue affects BizReview: from n/a through <= 1.5.13.

Action-Not Available
Vendor-Foysal Imran
Product-BizReview
CWE ID-CWE-862
Missing Authorization
CVE-2026-39715
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-5.3||MEDIUM
EPSS-0.04% / 10.85%
||
7 Day CHG+0.02%
Published-08 Apr, 2026 | 08:30
Updated-13 Apr, 2026 | 19:16
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress AnyTrack Affiliate Link Manager plugin <= 1.5.5 - Broken Access Control vulnerability

Missing Authorization vulnerability in AnyTrack AnyTrack Affiliate Link Manager anytrack-affiliate-link-manager allows Exploiting Incorrectly Configured Access Control Security Levels.This issue affects AnyTrack Affiliate Link Manager: from n/a through <= 1.5.5.

Action-Not Available
Vendor-AnyTrack
Product-AnyTrack Affiliate Link Manager
CWE ID-CWE-862
Missing Authorization
CVE-2026-39643
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-5.3||MEDIUM
EPSS-0.04% / 10.85%
||
7 Day CHG+0.02%
Published-08 Apr, 2026 | 08:30
Updated-13 Apr, 2026 | 19:31
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Payment Plugins for PayPal WooCommerce plugin <= 2.0.13 - Broken Access Control vulnerability

Missing Authorization vulnerability in Payment Plugins Payment Plugins for PayPal WooCommerce pymntpl-paypal-woocommerce allows Exploiting Incorrectly Configured Access Control Security Levels.This issue affects Payment Plugins for PayPal WooCommerce: from n/a through <= 2.0.13.

Action-Not Available
Vendor-Payment Plugins
Product-Payment Plugins for PayPal WooCommerce
CWE ID-CWE-862
Missing Authorization
CVE-2026-39699
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-5.3||MEDIUM
EPSS-0.04% / 10.85%
||
7 Day CHG+0.02%
Published-08 Apr, 2026 | 08:30
Updated-13 Apr, 2026 | 19:21
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress AI Workflow Automation plugin <= 1.4.2 - Broken Access Control vulnerability

Missing Authorization vulnerability in massiveshift AI Workflow Automation ai-workflow-automation-lite allows Exploiting Incorrectly Configured Access Control Security Levels.This issue affects AI Workflow Automation: from n/a through <= 1.4.2.

Action-Not Available
Vendor-massiveshift
Product-AI Workflow Automation
CWE ID-CWE-862
Missing Authorization
CVE-2026-39707
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-5.3||MEDIUM
EPSS-0.04% / 10.85%
||
7 Day CHG+0.02%
Published-08 Apr, 2026 | 08:30
Updated-13 Apr, 2026 | 19:17
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Accept PayPal Payments using Contact Form 7 plugin <= 4.0.4 - Broken Access Control vulnerability

Missing Authorization vulnerability in ZealousWeb Accept PayPal Payments using Contact Form 7 contact-form-7-paypal-extension allows Exploiting Incorrectly Configured Access Control Security Levels.This issue affects Accept PayPal Payments using Contact Form 7: from n/a through <= 4.0.4.

Action-Not Available
Vendor-ZealousWeb
Product-Accept PayPal Payments using Contact Form 7
CWE ID-CWE-862
Missing Authorization
CVE-2026-39701
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-5.3||MEDIUM
EPSS-0.04% / 10.85%
||
7 Day CHG+0.02%
Published-08 Apr, 2026 | 08:30
Updated-13 Apr, 2026 | 19:20
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress ShopWP plugin <= 5.2.4 - Broken Access Control vulnerability

Missing Authorization vulnerability in Andrew ShopWP wpshopify allows Exploiting Incorrectly Configured Access Control Security Levels.This issue affects ShopWP: from n/a through <= 5.2.4.

Action-Not Available
Vendor-Andrew
Product-ShopWP
CWE ID-CWE-862
Missing Authorization
CVE-2026-39658
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-5.3||MEDIUM
EPSS-0.04% / 10.85%
||
7 Day CHG+0.02%
Published-08 Apr, 2026 | 08:30
Updated-13 Apr, 2026 | 19:28
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Panda Pods Repeater Field plugin <= 1.5.12 - Broken Access Control vulnerability

Missing Authorization vulnerability in Coding Panda Panda Pods Repeater Field panda-pods-repeater-field allows Exploiting Incorrectly Configured Access Control Security Levels.This issue affects Panda Pods Repeater Field: from n/a through <= 1.5.12.

Action-Not Available
Vendor-Coding Panda
Product-Panda Pods Repeater Field
CWE ID-CWE-862
Missing Authorization
CVE-2026-35179
Matching Score-4
Assigner-GitHub, Inc.
ShareView Details
Matching Score-4
Assigner-GitHub, Inc.
CVSS Score-5.3||MEDIUM
EPSS-0.05% / 15.26%
||
7 Day CHG+0.01%
Published-06 Apr, 2026 | 19:05
Updated-07 Apr, 2026 | 16:14
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WWBN AVideo Unauthenticated Instagram Graph API Proxy via publishInstagram.json.php

WWBN AVideo is an open source video platform. In versions 26.0 and prior, the SocialMediaPublisher plugin exposes a publishInstagram.json.php endpoint that acts as an unauthenticated proxy to the Facebook/Instagram Graph API. The endpoint accepts user-controlled parameters including an access token, container ID, and Instagram account ID, and passes them directly to the Graph API via InstagramUploader::publishMediaIfIsReady(). This allows any unauthenticated user to make arbitrary Graph API calls through the server, potentially using stolen tokens or abusing the platform's own credentials.

Action-Not Available
Vendor-WWBN
Product-AVideo
CWE ID-CWE-862
Missing Authorization
CVE-2026-39705
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-5.3||MEDIUM
EPSS-0.04% / 10.85%
||
7 Day CHG+0.02%
Published-08 Apr, 2026 | 08:30
Updated-13 Apr, 2026 | 19:18
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress MIPL WC Multisite Sync plugin <= 1.4.4 - Broken Access Control vulnerability

Missing Authorization vulnerability in Mulika Team MIPL WC Multisite Sync mipl-wc-multisite-sync allows Exploiting Incorrectly Configured Access Control Security Levels.This issue affects MIPL WC Multisite Sync: from n/a through <= 1.4.4.

Action-Not Available
Vendor-Mulika Team
Product-MIPL WC Multisite Sync
CWE ID-CWE-862
Missing Authorization
CVE-2026-39660
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-5.3||MEDIUM
EPSS-0.04% / 10.85%
||
7 Day CHG+0.02%
Published-08 Apr, 2026 | 08:30
Updated-13 Apr, 2026 | 19:16
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress WP Job Manager plugin <= 2.4.1 - Broken Access Control vulnerability

Missing Authorization vulnerability in Automattic WP Job Manager wp-job-manager allows Exploiting Incorrectly Configured Access Control Security Levels.This issue affects WP Job Manager: from n/a through <= 2.4.1.

Action-Not Available
Vendor-Automattic Inc.
Product-WP Job Manager
CWE ID-CWE-862
Missing Authorization
CVE-2026-39608
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-5.3||MEDIUM
EPSS-0.04% / 10.85%
||
7 Day CHG+0.02%
Published-08 Apr, 2026 | 08:30
Updated-13 Apr, 2026 | 19:34
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress iPOSpays Gateways WC plugin <= 1.3.7 - Broken Access Control vulnerability

Missing Authorization vulnerability in iPOSPays iPOSpays Gateways WC ipospays-gateways-wc allows Exploiting Incorrectly Configured Access Control Security Levels.This issue affects iPOSpays Gateways WC: from n/a through <= 1.3.7.

Action-Not Available
Vendor-iPOSPays
Product-iPOSpays Gateways WC
CWE ID-CWE-862
Missing Authorization
CVE-2026-39588
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-5.3||MEDIUM
EPSS-0.04% / 10.85%
||
7 Day CHG+0.02%
Published-08 Apr, 2026 | 08:30
Updated-13 Apr, 2026 | 19:36
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress NM Gift Registry and Wishlist Lite plugin <= 5.13 - Broken Access Control vulnerability

Missing Authorization vulnerability in nmerii NM Gift Registry and Wishlist Lite nm-gift-registry-and-wishlist-lite allows Exploiting Incorrectly Configured Access Control Security Levels.This issue affects NM Gift Registry and Wishlist Lite: from n/a through <= 5.13.

Action-Not Available
Vendor-nmerii
Product-NM Gift Registry and Wishlist Lite
CWE ID-CWE-862
Missing Authorization
CVE-2026-39622
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-5.3||MEDIUM
EPSS-0.04% / 10.85%
||
7 Day CHG+0.02%
Published-08 Apr, 2026 | 08:30
Updated-13 Apr, 2026 | 19:32
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Education Base theme <= 3.0.8 - Broken Access Control vulnerability

Missing Authorization vulnerability in acmethemes Education Base education-base allows Exploiting Incorrectly Configured Access Control Security Levels.This issue affects Education Base: from n/a through <= 3.0.8.

Action-Not Available
Vendor-acmethemes
Product-Education Base
CWE ID-CWE-862
Missing Authorization
  • Previous
  • 1
  • 2
  • 3
  • ...
  • 13
  • 14
  • Next
Details not found