Logo
-

Byte Open Security

(ByteOS Network)

Log In

Sign Up

ByteOS

Security
Vulnerability Details
Registries
Custom Views
Weaknesses
Attack Patterns
Filters & Tools
Vulnerability Details :

CVE-2026-7430

Summary
Assigner-Wordfence
Assigner Org ID-b15e7b5b-3da4-40ae-a43c-f7aa60e62599
Published At-29 May, 2026 | 02:27
Updated At-29 May, 2026 | 10:07
Rejected At-
Credits

Post Snippets <= 4.0.19 - Authenticated (Administrator+) Stored Cross-Site Scripting via Import

The Post Snippets plugin for WordPress is vulnerable to Stored Cross-Site Scripting in all versions up to, and including, 4.0.19. This is due to insufficient output escaping of imported snippet content when rendering JavaScript variables in the post editor. Specifically, the `jqueryUiDialog()` method in `WPEditor.php` embeds snippet content directly into JavaScript string literals without escaping double quotes (the quote-escaping code on line 214 is commented out). When snippets are imported via the Import/Export feature, the content bypasses WordPress's `wp_magic_quotes()` (which would otherwise add protective backslashes), allowing double quotes in snippet content to break out of the JavaScript string context. This makes it possible for authenticated attackers, with Administrator-level access and above, to inject arbitrary web scripts via a malicious import file that execute whenever any administrator accesses a post editor page. Please note that this does not affect single-site installations as administrators already have the `unfiltered_html` capability.

Vendors
-
Not available
Products
-
Metrics (CVSS)
VersionBase scoreBase severityVector
Weaknesses
Attack Patterns
Solution/Workaround
References
HyperlinkResource Type
EPSS History
Score
Latest Score
-
N/A
No data available for selected date range
Percentile
Latest Percentile
-
N/A
No data available for selected date range
Stakeholder-Specific Vulnerability Categorization (SSVC)
▼Common Vulnerabilities and Exposures (CVE)
cve.org
Assigner:Wordfence
Assigner Org ID:b15e7b5b-3da4-40ae-a43c-f7aa60e62599
Published At:29 May, 2026 | 02:27
Updated At:29 May, 2026 | 10:07
Rejected At:
▼CVE Numbering Authority (CNA)
Post Snippets <= 4.0.19 - Authenticated (Administrator+) Stored Cross-Site Scripting via Import

The Post Snippets plugin for WordPress is vulnerable to Stored Cross-Site Scripting in all versions up to, and including, 4.0.19. This is due to insufficient output escaping of imported snippet content when rendering JavaScript variables in the post editor. Specifically, the `jqueryUiDialog()` method in `WPEditor.php` embeds snippet content directly into JavaScript string literals without escaping double quotes (the quote-escaping code on line 214 is commented out). When snippets are imported via the Import/Export feature, the content bypasses WordPress's `wp_magic_quotes()` (which would otherwise add protective backslashes), allowing double quotes in snippet content to break out of the JavaScript string context. This makes it possible for authenticated attackers, with Administrator-level access and above, to inject arbitrary web scripts via a malicious import file that execute whenever any administrator accesses a post editor page. Please note that this does not affect single-site installations as administrators already have the `unfiltered_html` capability.

Affected Products
Vendor
saadiqbal
Product
Post Snippets – Custom WordPress Code Snippets Customizer
Default Status
unaffected
Versions
Affected
  • From 0 through 4.0.19 (semver)
Problem Types
TypeCWE IDDescription
CWECWE-79CWE-79 Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
Type: CWE
CWE ID: CWE-79
Description: CWE-79 Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
Metrics
VersionBase scoreBase severityVector
3.14.4MEDIUM
CVSS:3.1/AV:N/AC:H/PR:H/UI:N/S:C/C:L/I:L/A:N
Version: 3.1
Base score: 4.4
Base severity: MEDIUM
Vector:
CVSS:3.1/AV:N/AC:H/PR:H/UI:N/S:C/C:L/I:L/A:N
Metrics Other Info
Impacts
CAPEC IDDescription
Solutions

Configurations

Workarounds

Exploits

Credits

finder
Albatross George
Timeline
EventDate
Vendor Notified2026-04-29 15:31:17
Disclosed2026-05-28 13:41:27
Event: Vendor Notified
Date: 2026-04-29 15:31:17
Event: Disclosed
Date: 2026-05-28 13:41:27
Replaced By

Rejected Reason

References
HyperlinkResource
https://www.wordfence.com/threat-intel/vulnerabilities/id/59dc2448-491c-478f-a784-c727057b126b?source=cve
N/A
https://plugins.trac.wordpress.org/browser/post-snippets/tags/4.0.19/src/PostSnippets/WPEditor.php#L218
N/A
https://plugins.trac.wordpress.org/browser/post-snippets/trunk/src/PostSnippets/WPEditor.php#L218
N/A
https://plugins.trac.wordpress.org/browser/post-snippets/tags/4.0.19/src/PostSnippets/DBTable.php#L114
N/A
https://plugins.trac.wordpress.org/browser/post-snippets/trunk/src/PostSnippets/DBTable.php#L114
N/A
https://plugins.trac.wordpress.org/browser/post-snippets/tags/4.1.1/src/PostSnippets/WPEditor.php#L20
N/A
https://plugins.trac.wordpress.org/browser/post-snippets/tags/4.1.1/src/PostSnippets/WPEditor.php#L221
N/A
https://plugins.trac.wordpress.org/browser/post-snippets/tags/4.1.1/src/PostSnippets/WPEditor.php#L227
N/A
Hyperlink: https://www.wordfence.com/threat-intel/vulnerabilities/id/59dc2448-491c-478f-a784-c727057b126b?source=cve
Resource: N/A
Hyperlink: https://plugins.trac.wordpress.org/browser/post-snippets/tags/4.0.19/src/PostSnippets/WPEditor.php#L218
Resource: N/A
Hyperlink: https://plugins.trac.wordpress.org/browser/post-snippets/trunk/src/PostSnippets/WPEditor.php#L218
Resource: N/A
Hyperlink: https://plugins.trac.wordpress.org/browser/post-snippets/tags/4.0.19/src/PostSnippets/DBTable.php#L114
Resource: N/A
Hyperlink: https://plugins.trac.wordpress.org/browser/post-snippets/trunk/src/PostSnippets/DBTable.php#L114
Resource: N/A
Hyperlink: https://plugins.trac.wordpress.org/browser/post-snippets/tags/4.1.1/src/PostSnippets/WPEditor.php#L20
Resource: N/A
Hyperlink: https://plugins.trac.wordpress.org/browser/post-snippets/tags/4.1.1/src/PostSnippets/WPEditor.php#L221
Resource: N/A
Hyperlink: https://plugins.trac.wordpress.org/browser/post-snippets/tags/4.1.1/src/PostSnippets/WPEditor.php#L227
Resource: N/A
▼Authorized Data Publishers (ADP)
CISA ADP Vulnrichment
Affected Products
Metrics
VersionBase scoreBase severityVector
Metrics Other Info
Impacts
CAPEC IDDescription
Solutions

Configurations

Workarounds

Exploits

Credits

Timeline
EventDate
Replaced By

Rejected Reason

References
HyperlinkResource
Information is not available yet
▼National Vulnerability Database (NVD)
nvd.nist.gov
Source:security@wordfence.com
Published At:29 May, 2026 | 04:17
Updated At:29 May, 2026 | 13:09

The Post Snippets plugin for WordPress is vulnerable to Stored Cross-Site Scripting in all versions up to, and including, 4.0.19. This is due to insufficient output escaping of imported snippet content when rendering JavaScript variables in the post editor. Specifically, the `jqueryUiDialog()` method in `WPEditor.php` embeds snippet content directly into JavaScript string literals without escaping double quotes (the quote-escaping code on line 214 is commented out). When snippets are imported via the Import/Export feature, the content bypasses WordPress's `wp_magic_quotes()` (which would otherwise add protective backslashes), allowing double quotes in snippet content to break out of the JavaScript string context. This makes it possible for authenticated attackers, with Administrator-level access and above, to inject arbitrary web scripts via a malicious import file that execute whenever any administrator accesses a post editor page. Please note that this does not affect single-site installations as administrators already have the `unfiltered_html` capability.

CISA Catalog
Date AddedDue DateVulnerability NameRequired Action
N/A
Date Added: N/A
Due Date: N/A
Vulnerability Name: N/A
Required Action: N/A
Metrics
TypeVersionBase scoreBase severityVector
Primary3.14.4MEDIUM
CVSS:3.1/AV:N/AC:H/PR:H/UI:N/S:C/C:L/I:L/A:N
Type: Primary
Version: 3.1
Base score: 4.4
Base severity: MEDIUM
Vector:
CVSS:3.1/AV:N/AC:H/PR:H/UI:N/S:C/C:L/I:L/A:N
CPE Matches

Weaknesses
CWE IDTypeSource
CWE-79Primarysecurity@wordfence.com
CWE ID: CWE-79
Type: Primary
Source: security@wordfence.com
Evaluator Description

Evaluator Impact

Evaluator Solution

Vendor Statements

References
HyperlinkSourceResource
https://plugins.trac.wordpress.org/browser/post-snippets/tags/4.0.19/src/PostSnippets/DBTable.php#L114security@wordfence.com
N/A
https://plugins.trac.wordpress.org/browser/post-snippets/tags/4.0.19/src/PostSnippets/WPEditor.php#L218security@wordfence.com
N/A
https://plugins.trac.wordpress.org/browser/post-snippets/tags/4.1.1/src/PostSnippets/WPEditor.php#L20security@wordfence.com
N/A
https://plugins.trac.wordpress.org/browser/post-snippets/tags/4.1.1/src/PostSnippets/WPEditor.php#L221security@wordfence.com
N/A
https://plugins.trac.wordpress.org/browser/post-snippets/tags/4.1.1/src/PostSnippets/WPEditor.php#L227security@wordfence.com
N/A
https://plugins.trac.wordpress.org/browser/post-snippets/trunk/src/PostSnippets/DBTable.php#L114security@wordfence.com
N/A
https://plugins.trac.wordpress.org/browser/post-snippets/trunk/src/PostSnippets/WPEditor.php#L218security@wordfence.com
N/A
https://www.wordfence.com/threat-intel/vulnerabilities/id/59dc2448-491c-478f-a784-c727057b126b?source=cvesecurity@wordfence.com
N/A
Hyperlink: https://plugins.trac.wordpress.org/browser/post-snippets/tags/4.0.19/src/PostSnippets/DBTable.php#L114
Source: security@wordfence.com
Resource: N/A
Hyperlink: https://plugins.trac.wordpress.org/browser/post-snippets/tags/4.0.19/src/PostSnippets/WPEditor.php#L218
Source: security@wordfence.com
Resource: N/A
Hyperlink: https://plugins.trac.wordpress.org/browser/post-snippets/tags/4.1.1/src/PostSnippets/WPEditor.php#L20
Source: security@wordfence.com
Resource: N/A
Hyperlink: https://plugins.trac.wordpress.org/browser/post-snippets/tags/4.1.1/src/PostSnippets/WPEditor.php#L221
Source: security@wordfence.com
Resource: N/A
Hyperlink: https://plugins.trac.wordpress.org/browser/post-snippets/tags/4.1.1/src/PostSnippets/WPEditor.php#L227
Source: security@wordfence.com
Resource: N/A
Hyperlink: https://plugins.trac.wordpress.org/browser/post-snippets/trunk/src/PostSnippets/DBTable.php#L114
Source: security@wordfence.com
Resource: N/A
Hyperlink: https://plugins.trac.wordpress.org/browser/post-snippets/trunk/src/PostSnippets/WPEditor.php#L218
Source: security@wordfence.com
Resource: N/A
Hyperlink: https://www.wordfence.com/threat-intel/vulnerabilities/id/59dc2448-491c-478f-a784-c727057b126b?source=cve
Source: security@wordfence.com
Resource: N/A

Change History

0
Information is not available yet

Similar CVEs

285Records found

CVE-2024-0656
Matching Score-10
Assigner-Wordfence
ShareView Details
Matching Score-10
Assigner-Wordfence
CVSS Score-4.4||MEDIUM
EPSS-0.28% / 51.58%
||
7 Day CHG~0.00%
Published-20 Feb, 2024 | 18:56
Updated-08 Apr, 2026 | 19:19
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Password Protected <= 2.6.6 - Authenticated (Admin+) Stored Cross-Site Scripting

The Password Protected – Ultimate Plugin to Password Protect Your WordPress Content with Ease plugin for WordPress is vulnerable to Stored Cross-Site Scripting via the Google Captcha Site Key in all versions up to, and including, 2.6.6 due to insufficient input sanitization and output escaping. This makes it possible for authenticated attackers, with administrator-level access, to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page. This only affects multi-site installations and installations where unfiltered_html has been disabled.

Action-Not Available
Vendor-wpexpertssaadiqbal
Product-password_protectedPassword Protected — Lock Entire Site, Pages, Posts, Categories, and Partial Content
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2024-13805
Matching Score-6
Assigner-Wordfence
ShareView Details
Matching Score-6
Assigner-Wordfence
CVSS Score-6.4||MEDIUM
EPSS-0.11% / 28.85%
||
7 Day CHG~0.00%
Published-07 Mar, 2025 | 09:21
Updated-08 Apr, 2026 | 16:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Advanced File Manager <= 5.2.14 - Authenticated (Subscriber+) Stored Cross-Site Scripting via SVG File Upload

The Advanced File Manager — Ultimate WordPress File Manager and Document Library Plugin plugin for WordPress is vulnerable to Stored Cross-Site Scripting via SVG File uploads in all versions up to, and including, 5.2.14 due to insufficient input sanitization and output escaping. This makes it possible for authenticated attackers, with Subscriber-level access and above, and granted permissions by an Administrator, to inject arbitrary web scripts in pages that will execute whenever a user accesses the SVG file.

Action-Not Available
Vendor-advancedfilemanagersaadiqbal
Product-advanced_file_managerAdvanced File Manager – Ultimate File Manager for WordPress And Document Library Solution
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2024-13362
Matching Score-6
Assigner-Wordfence
ShareView Details
Matching Score-6
Assigner-Wordfence
CVSS Score-6.1||MEDIUM
EPSS-0.14% / 33.13%
||
7 Day CHG~0.00%
Published-01 May, 2026 | 05:29
Updated-01 May, 2026 | 13:23
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Freemius <= 2.10.1 - Reflected DOM-Based Cross-Site Scripting via url Parameter

Multiple plugins and/or themes for WordPress are vulnerable to Reflected Cross-Site Scripting via the url parameter in various versions due to insufficient input sanitization and output escaping. This makes it possible for unauthenticated attackers to inject arbitrary web scripts in pages that execute if they can successfully trick a user into performing an action such as clicking on a link.

Action-Not Available
Vendor-sjavedspicethemeswpsaadblackandwhitedigitalkaizencodersessekiajosevegaspeedifypluginscafethemelocationtobiasbgpluginswaredamian-goramikewire_rocksolidparetodigitalspiderdevswpdeverkoen12344wpbitsbensibleypeterschulznlinaviigallerycreatorlitonice13gowebsmartyimtiazrayhanuriahs-victorgn_themessamdanimhmrajibnicheaddonsyuvalocyberhobomapsterblocksparecyclonecode100pluginsbpluginsstreamweaselssebetpassionatebrainswpjolisaadiqbalwpspeedooceanwpxplodedthemesinteractivegeomapspremmercetakanakuimihail-barinovsenolsmte90tobias_conradcleverpluginsnitin247elliotvstheafricanbossfoopluginstonyzeolikairapluginandplayhasanazizulplugins360meowcrewelespareinvisnetwordplusvinod-dalviwebheadllc5starpluginskofimokomecodesavorysmartwpresswebba-agencypagupfullworkstripettodashlabsltdinfornwebmohsinofflinehkdigitalagencymattpramschufertickeradavidandersonprasadkirpekarprinceahmedwpmagicstoddhalfpennyseezeeinfosatechwebfactorybouncingsproutunitecmsenwebymr2prebelcodeBiplob Adhikari (Oxilab Development)AF themes
Product-Post to Google My Business (Google Business Profile)Mapster WP MapsShare This ImageFeatured Images in RSS for Mailchimp & MoreBetter Messages – Live Chat, Chat Rooms, Real-Time Messaging & Private MessagesGo Fetch Jobs (for WP Job Manager)Post Slider and Post Carousel with Post Vertical Scrolling Widget – A Responsive Post SliderMixed Media Gallery BlocksFive-Star Ratings ShortcodeAI Bud – AI Content Generator, AI Chatbot, ChatGPT, Gemini, GPT-4oAI Puffer – Chat. Create. Automate. (formerly AI Power)Auto-Install Free SSL – Generate & Install Free SSL CertificatesCarousel, Recent Post Slider and Banner SliderDisable Payment Methods based on cart conditions for WooCommerceXT Floating Cart for WooCommercePrimary Addon for ElementorUnlimited Elements For ElementorNotification Bar, Announcement and Cookie Notice WordPress Plugin – FooBarEasy Appointment Booking & Scheduling System – Webba Booking CalendarXT Quick View for WooCommerceWOW Styler for CF7 – Visual Styler for Contact Form 7 FormsEazyDocs – AI Powered Knowledge Base, Wiki, Documentation & FAQ BuilderMessage Filter for Contact Form 7Post SMTP – Complete Email Deliverability and SMTP Solution with Email Logs, Alerts, Backup SMTP & Mobile AppTreePress – Easy Family Trees & Ancestor ProfilesEasy Age VerifyRadio Station by netmix® – Manage and play your Show Schedule in WordPress!GA4WP – Analytics Dashboard for the WebsiteEmbedder for Google ReviewsPremmerce Permalink Manager for WooCommerceSolid Testimonials – Testimonial Slider, Video Testimonials & Customer ReviewsWP Notification BellCustom WooCommerce Checkout Fields EditorWP fail2ban – Advanced SecurityInternal Link Juicer: SEO Auto Linker for WordPressAdvanced Classifieds & Directory ProWPBITS Addons For Elementor Page BuilderMenu Image, Icons made easyFile Manager for Google Drive – Integrate Google DriveWP Meta and Date RemoverGeo MashupBlog Designer Pack – Blog, Post Grid, Post Slider, Post Carousel, Category Post, NewsGlossaryEleSpare – News, Magazine and Blog Addons for ElementorJustified GalleryStreamWeasels Twitch IntegrationWP Books Gallery – Build Stunning Book Showcases & Libraries in MinutesPremmerce Product Filter for WooCommerceBulk Auto Image Alt Text (Alt tag, Alt attribute) optimizer (image SEO)Ivory Search – WordPress Search PluginAnnouncement & Notification Banner – BulletinWPIDE – File Manager & Code EditorWP Encryption – One Click Free SSL Certificate & SSL / HTTPS Redirect, Security & SSL ScanbBlocks – Essential Gutenberg Blocks & Patterns CollectionDynamic Copyright YearDisplay Eventbrite EventsRestaurant & Cafe Addon for ElementorSpotlight Social Feeds – Block, Shortcode, and WidgetLogo Showcase – Responsive Logo Carousel, Logo Slider & Logo GridWordPress form builder plugin for contact forms, surveys and quizzes – TripettoWP Coupons and Deals – Coupon Plugin For Affiliate MarketersThank You Page for WooCommerceGoal Tracker – Custom Event Tracking for GA4Post List Designer – Category Post, Recent Post, Post ListWP Data Access – App Builder for Tables, Forms, Charts, Maps & DashboardsRestrict – membership, site, content and user access restrictions for WordPressKikote – Location Picker at Checkout & Google Address AutoFill Plugin for WooCommerceJoli Table Of ContentsCheckout with Cash App on WooCommerceIndependent AnalyticsEvents Addon for ElementorAutomatic Internal Links for SEO by PagupUltimeterPay For Post with WooCommerceTeam Members – A WordPress Team Plugin with Gallery, Grid, Carousel, Slider, Table, List, and MoreYASR – Yet Another Star Rating Plugin for WordPressMaster Addons For Elementor – Widgets, Extensions, Theme Builder, Popup Builder & Template KitsRole Based Pricing for Woo by Meow CrewOcean ExtraRadio Player – Live Shoutcast, Icecast and Any Audio Stream PlayerMeta Field Block – Display custom fields in the Block Editor without codingOpen User MapTablesome Table – Contact Form DB – WPForms, CF7, Gravity, Forminator, FluentCode ManagerText To Speech TTS AccessibilityAnti-Spam Protection – No API Key, GDPR FriendlyGallery by FooGalleryAutomatic YouTube GalleryStoreCustomizer – A plugin to Customize all WooCommerce PagesWP Page TemplatesAidWP – Donation & Payment Forms (Stripe Powered)WP Post Author – Author Box, Multiple Authors, Guest Authors & Custom AvatarsSecure Gateway for Authorize.net and WooCommerce by Pledged PluginsPayment Gateway for ACBA BANKProduct Layouts for WooCommerceAdvanced Scrollbar – Custom Scrollbar Styling and BehaviorSecurity Ninja – WordPress Security & FirewallXT Variation Swatches for WooCommerceDelete Posts automaticallyWidgets on PagesTablePress – Tables in WordPress made easyContact Form 7 Multi-Step FormsRevivePress – Keep your Old Content EvergreenHTML5 Audio Player – The Ultimate No-Code Podcast, MP3 & Audio PlayerAEH Speed Optimization: Browser Cache, Optimized Minify, Lazy Loading & Image OptimizationAWCA – The Great Analytics Insights for Your eStoreImage Alt Text Manager – Bulk & Dynamic Alt Tags For image SEO Optimization + AISmart phone field for Gravity FormsBulk Edit Posts and Products in SpreadsheetMarijuana Age VerifyForumax – AI Powered Advanced Community Forum PluginMusic Player for Elementor – Audio Player & Podcast PlayerFull Screen BackgroundMapGeo – Interactive Geo MapsKnowledge Base documentation & wiki plugin – BasePress DocsBlockSpare — News, Magazine and Blog Addons for (Gutenberg) Block EditorCoupon Affiliates – Affiliate Plugin for WooCommercePlace Order Without Payment for WooCommerceLightbox & Modal Popup WordPress Plugin – FooBoxWP Mobile Menu – The Mobile-Friendly Responsive MenuCustom PHP SettingsInavii Social FeedSend Users Email – Email Subscribers, Email Marketing NewsletterWP Shortcodes Plugin — Shortcodes UltimateDracula Dark Mode – Accessibility, Reading Mode & Dark Mode for WordPressPDF Poster – Display PDF Files with Custom ViewerEasy Social Feed – Social Photos Gallery and Post Feed for WordPressTeam Members ShowcaseURL Shortify – Simple and Easy URL ShortenerTopNewsWp – Display Tikcer News, RSS Feed Widget and Many MoreRemove Add to Cart WooCommerce
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2024-10187
Matching Score-6
Assigner-Wordfence
ShareView Details
Matching Score-6
Assigner-Wordfence
CVSS Score-6.4||MEDIUM
EPSS-0.30% / 54.15%
||
7 Day CHG~0.00%
Published-08 Nov, 2024 | 09:29
Updated-08 Apr, 2026 | 16:41
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
myCred <= 2.7.4 - Authenticated (Contributor+) Stored Cross-Site Scripting via mycred_link Shortcode

The myCred – Loyalty Points and Rewards plugin for WordPress and WooCommerce – Give Points, Ranks, Badges, Cashback, WooCommerce rewards, and WooCommerce credits for Gamification plugin for WordPress is vulnerable to Stored Cross-Site Scripting via the plugin's mycred_link shortcode in all versions up to, and including, 2.7.4 due to insufficient input sanitization and output escaping on user supplied attributes. This makes it possible for authenticated attackers, with contributor-level access and above, to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page.

Action-Not Available
Vendor-mycredsaadiqbal
Product-mycredPoints Management System For Gamification, Ranks, Badges, and Loyalty Rewards Program – myCred
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2023-3082
Matching Score-6
Assigner-Wordfence
ShareView Details
Matching Score-6
Assigner-Wordfence
CVSS Score-7.2||HIGH
EPSS-0.99% / 77.31%
||
7 Day CHG~0.00%
Published-12 Jul, 2023 | 04:38
Updated-08 Apr, 2026 | 18:18
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Post SMTP <= 2.5.7 - Unauthenticated Stored Cross-Site Scripting via Email

The Post SMTP plugin for WordPress is vulnerable to Stored Cross-Site Scripting via email contents in versions up to, and including, 2.5.7 due to insufficient input sanitization and output escaping. This makes it possible for unauthenticated attackers to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page.

Action-Not Available
Vendor-wpexpertssaadiqbal
Product-post_smtpPost SMTP – Complete Email Deliverability and SMTP Solution with Email Logs, Alerts, Backup SMTP & Mobile App
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2023-6629
Matching Score-6
Assigner-Wordfence
ShareView Details
Matching Score-6
Assigner-Wordfence
CVSS Score-6.1||MEDIUM
EPSS-0.50% / 66.37%
||
7 Day CHG~0.00%
Published-03 Jan, 2024 | 04:29
Updated-08 Apr, 2026 | 18:18
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
POST SMTP Mailer <= 2.8.6 - Reflected Cross-Site Scripting via msg

The POST SMTP Mailer – Email log, Delivery Failure Notifications and Best Mail SMTP for WordPress plugin for WordPress is vulnerable to Reflected Cross-Site Scripting via the ‘msg’ parameter in all versions up to, and including, 2.8.6 due to insufficient input sanitization and output escaping. This makes it possible for unauthenticated attackers to inject arbitrary web scripts in pages that execute if they can successfully trick a user into performing an action such as clicking on a link. CVE-2023-6621 appears to be a duplicate of this issue. CVE-2024-29128 appears to be a duplicate of this issue.

Action-Not Available
Vendor-wpexpertssaadiqbal
Product-post_smtpPost SMTP – Complete Email Deliverability and SMTP Solution with Email Logs, Alerts, Backup SMTP & Mobile App
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2025-0521
Matching Score-6
Assigner-Wordfence
ShareView Details
Matching Score-6
Assigner-Wordfence
CVSS Score-7.2||HIGH
EPSS-0.41% / 61.84%
||
7 Day CHG~0.00%
Published-18 Feb, 2025 | 11:10
Updated-08 Apr, 2026 | 16:46
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Post SMTP <= 3.0.2 - Unauthenticated Stored Cross-Site Scripting

The Post SMTP plugin for WordPress is vulnerable to Stored Cross-Site Scripting via the from and subject parameter in all versions up to, and including, 3.0.2 due to insufficient input sanitization and output escaping. This makes it possible for unauthenticated attackers to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page.

Action-Not Available
Vendor-wpexpertssaadiqbal
Product-post_smtpPost SMTP – Complete Email Deliverability and SMTP Solution with Email Logs, Alerts, Backup SMTP & Mobile App
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2026-3090
Matching Score-6
Assigner-Wordfence
ShareView Details
Matching Score-6
Assigner-Wordfence
CVSS Score-7.2||HIGH
EPSS-0.12% / 30.82%
||
7 Day CHG~0.00%
Published-18 Mar, 2026 | 15:28
Updated-22 Apr, 2026 | 21:32
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Post SMTP <= 3.8.0 - Unauthenticated Stored Cross-Site Scripting via 'event_type'

The Post SMTP – Complete Email Deliverability and SMTP Solution with Email Logs, Alerts, Backup SMTP & Mobile App plugin for WordPress is vulnerable to Stored Cross-Site Scripting via the ‘event_type’ parameter in all versions up to, and including, 3.8.0 due to insufficient input sanitization and output escaping. This makes it possible for unauthenticated attackers to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page. The vulnerability is only exploitable when the Post SMTP Pro plugin is also installed and its Reporting and Tracking extension is enabled.

Action-Not Available
Vendor-saadiqbal
Product-Post SMTP – Complete Email Deliverability and SMTP Solution with Email Logs, Alerts, Backup SMTP & Mobile App
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2024-11201
Matching Score-6
Assigner-Wordfence
ShareView Details
Matching Score-6
Assigner-Wordfence
CVSS Score-6.4||MEDIUM
EPSS-9.92% / 93.18%
||
7 Day CHG~0.00%
Published-06 Dec, 2024 | 05:26
Updated-15 Apr, 2026 | 00:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
myCred – Loyalty Points and Rewards plugin <= 2.7.5.2 - Authenticated (Contributor+) Stored Cross-Site Scripting via mycred_send Shortcode

The myCred – Loyalty Points and Rewards plugin for WordPress and WooCommerce – Give Points, Ranks, Badges, Cashback, WooCommerce rewards, and WooCommerce credits for Gamification plugin for WordPress is vulnerable to Stored Cross-Site Scripting via the plugin's mycred_send shortcode in all versions up to, and including, 2.7.5.2 due to insufficient input sanitization and output escaping on user supplied attributes. This makes it possible for authenticated attackers, with contributor-level access and above, to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page.

Action-Not Available
Vendor-saadiqbal
Product-Points Management System For Gamification, Ranks, Badges, and Loyalty Rewards Program – myCred
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2026-0550
Matching Score-6
Assigner-Wordfence
ShareView Details
Matching Score-6
Assigner-Wordfence
CVSS Score-6.4||MEDIUM
EPSS-0.04% / 13.54%
||
7 Day CHG~0.00%
Published-14 Feb, 2026 | 08:26
Updated-08 Apr, 2026 | 17:24
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
myCred <= 2.9.7.3 - Authenticated (Contributor+) Stored Cross-Site Scripting via 'mycred_load_coupon' Shortcode

The myCred plugin for WordPress is vulnerable to Stored Cross-Site Scripting via the plugin's 'mycred_load_coupon' shortcode in all versions up to, and including, 2.9.7.3 due to insufficient input sanitization and output escaping on user supplied attributes. This makes it possible for authenticated attackers, with contributor level access and above, to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page.

Action-Not Available
Vendor-saadiqbal
Product-Points Management System For Gamification, Ranks, Badges, and Loyalty Rewards Program – myCred
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2023-7027
Matching Score-6
Assigner-Wordfence
ShareView Details
Matching Score-6
Assigner-Wordfence
CVSS Score-7.2||HIGH
EPSS-0.79% / 74.35%
||
7 Day CHG~0.00%
Published-03 Jan, 2024 | 04:29
Updated-08 Apr, 2026 | 18:18
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
POST SMTP Mailer – Email log, Delivery Failure Notifications and Best Mail SMTP for WordPress <= 2.8.7 - Unauthenticated Stored Cross-Site Scripting via device

The POST SMTP Mailer – Email log, Delivery Failure Notifications and Best Mail SMTP for WordPress plugin for WordPress is vulnerable to Stored Cross-Site Scripting via the ‘device’ header in all versions up to, and including, 2.8.7 due to insufficient input sanitization and output escaping. This makes it possible for unauthenticated attackers to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page.

Action-Not Available
Vendor-wpexpertssaadiqbal
Product-post_smtpPost SMTP – Complete Email Deliverability and SMTP Solution with Email Logs, Alerts, Backup SMTP & Mobile App
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2024-13517
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.4||MEDIUM
EPSS-0.25% / 48.11%
||
7 Day CHG+0.07%
Published-18 Jan, 2025 | 07:05
Updated-08 Apr, 2026 | 17:06
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Easy Digital Downloads – Sell Digital Files & Subscriptions (eCommerce Store + Payments Made Easy) <= 3.3.2 - Authenticated (Admin+) Stored Cross-Site Scripting via Title

The Easy Digital Downloads – eCommerce Payments and Subscriptions made easy plugin for WordPress is vulnerable to Stored Cross-Site Scripting via the Title value in all versions up to, and including, 3.3.2 due to insufficient input sanitization and output escaping. This makes it possible for authenticated attackers, with administrator-level access, to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page. This only affects multi-site installations and installations where unfiltered_html has been disabled.

Action-Not Available
Vendor-Awesome Motive Inc.
Product-easy_digital_downloadsEasy Digital Downloads – eCommerce Payments and Subscriptions made easy
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2024-1571
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.4||MEDIUM
EPSS-0.47% / 65.04%
||
7 Day CHG~0.00%
Published-09 Apr, 2024 | 18:58
Updated-08 Apr, 2026 | 18:20
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WP Recipe Maker <= 9.2.1 - Authenticated Stored Cross-Site Scripting via Video Embed

The WP Recipe Maker plugin for WordPress is vulnerable to Stored Cross-Site Scripting via the Video Embed parameter in all versions up to, and including, 9.2.1 due to insufficient input sanitization and output escaping. This makes it possible for authenticated attackers, with access to the recipe dashboard (which is administrator-only by default but can be assigned to arbitrary capabilities), to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page.

Action-Not Available
Vendor-bootstrappedbrechtvds
Product-wp_recipe_makerWP Recipe Maker
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2026-8991
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.4||MEDIUM
EPSS-0.04% / 12.04%
||
7 Day CHG~0.00%
Published-06 Jun, 2026 | 02:28
Updated-08 Jun, 2026 | 14:57
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Drag and Drop Multiple File Upload for Contact Form 7 <= 1.3.9.7 - Authenticated (Administrator+) Stored Cross-Site Scripting via 'drag_n_drop_text' and 'drag_n_drop_browse_text' Settings

The Drag and Drop Multiple File Upload for Contact Form 7 plugin for WordPress is vulnerable to Stored Cross-Site Scripting via 'drag_n_drop_text' and 'drag_n_drop_browse_text' Settings in all versions up to, and including, 1.3.9.7 due to insufficient input sanitization and output escaping. This makes it possible for authenticated attackers, with administrator-level access and above, to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page.

Action-Not Available
Vendor-glenwpcoder
Product-Drag and Drop Multiple File Upload for Contact Form 7
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2024-13519
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.4||MEDIUM
EPSS-0.19% / 40.23%
||
7 Day CHG+0.05%
Published-18 Jan, 2025 | 07:05
Updated-15 Apr, 2026 | 00:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
MarketKing — Ultimate WooCommerce Multivendor Marketplace Solution <= 1.9.80 - Authenticated (Shop Manager+) Stored Cross-Site Scripting

The MarketKing — Ultimate WooCommerce Multivendor Marketplace Solution plugin for WordPress is vulnerable to Stored Cross-Site Scripting via plugin's settings in all versions up to, and including, 1.9.80 due to insufficient input sanitization and output escaping. This makes it possible for authenticated attackers, with Shop Manager-level permissions and above, to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page. This only affects multi-site installations and installations where unfiltered_html has been disabled.

Action-Not Available
Vendor-webwizardsdev
Product-MarketKing — Ultimate WooCommerce Multivendor Marketplace Solution
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2024-1463
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.4||MEDIUM
EPSS-0.24% / 47.24%
||
7 Day CHG~0.00%
Published-09 Apr, 2024 | 18:59
Updated-08 Apr, 2026 | 19:20
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
LearnPress <= 4.2.6.3 - Authenticated(LP Instructor+) Stored Cross-Site Scripting

The LearnPress – WordPress LMS Plugin plugin for WordPress is vulnerable to Stored Cross-Site Scripting via the Course, Lesson, and Quiz title and content in all versions up to, and including, 4.2.6.3 due to insufficient input sanitization and output escaping. This makes it possible for authenticated attackers, with LP Instructor-level access, to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page.

Action-Not Available
Vendor-ThimPress (PhysCode)
Product-learnpressLearnPress – WordPress LMS Plugin for Create and Sell Online Courses
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2026-8853
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.4||MEDIUM
EPSS-0.03% / 10.22%
||
7 Day CHG~0.00%
Published-10 Jun, 2026 | 07:50
Updated-10 Jun, 2026 | 12:56
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
MW WP Form <= 5.1.3 - Authenticated (Editor+) Stored Cross-Site Scripting via 'memo' Parameter

The MW WP Form plugin for WordPress is vulnerable to Stored Cross-Site Scripting via the 'memo' parameter in all versions up to, and including, 5.1.3 due to insufficient input sanitization and output escaping. This makes it possible for authenticated attackers, with editor-level access and above, to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page. Because the memo value is stored via update_post_meta() rather than wp_insert_post(), WordPress's built-in kses and unfiltered_html protections do not apply, allowing attackers to break out of the textarea element via injected closing tags regardless of role-based content filtering.

Action-Not Available
Vendor-websoudan
Product-MW WP Form
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2024-13748
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.4||MEDIUM
EPSS-0.14% / 33.80%
||
7 Day CHG~0.00%
Published-20 Feb, 2025 | 09:21
Updated-08 Apr, 2026 | 16:43
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Ultimate Classified Listings <= 1.4 Authenticated (Administrator+) Stored Cross-Site Scripting via Title Parameter

The Ultimate Classified Listings plugin for WordPress is vulnerable to Stored Cross-Site Scripting via the Title parameter in all versions up to, and including, 1.4 due to insufficient input sanitization and output escaping. This makes it possible for authenticated attackers, with administrator-level access, to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page. This only affects multi-site installations and installations where unfiltered_html has been disabled.

Action-Not Available
Vendor-webcodingplacewebcodingplace
Product-ultimate_classified_listingsUltimate Classified Listings
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2024-12581
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.4||MEDIUM
EPSS-0.43% / 62.96%
||
7 Day CHG~0.00%
Published-13 Dec, 2024 | 05:24
Updated-08 Apr, 2026 | 16:48
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Kadence Blocks <= 3.2.53 - Authenticated (Admin+) Stored Cross-Site Scripting

The Gutenberg Blocks with AI by Kadence WP – Page Builder Features plugin for WordPress is vulnerable to Stored Cross-Site Scripting via admin settings in all versions up to, and including, 3.2.53 due to insufficient input sanitization and output escaping. This makes it possible for authenticated attackers, with administrator-level permissions and above, to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page. This only affects multi-site installations and installations where unfiltered_html has been disabled.

Action-Not Available
Vendor-The Events Calendar (StellarWP)Kadence WP
Product-gutenberg_blocks_with_aiKadence Blocks — Page Builder Toolkit for Gutenberg Editor
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2025-2799
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.4||MEDIUM
EPSS-0.18% / 38.90%
||
7 Day CHG~0.00%
Published-16 Jul, 2025 | 05:23
Updated-08 Apr, 2026 | 17:13
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WP Event Manager <= 3.1.49 - Authenticated (Administrator+) Stored Cross-Site Scripting

The WP Event Manager – Events Calendar, Registrations, Sell Tickets with WooCommerce plugin for WordPress is vulnerable to Stored Cross-Site Scripting via the ‘tag-name’ parameter in all versions up to, and including, 3.1.49 due to insufficient input sanitization and output escaping. This makes it possible for authenticated attackers, with administrator-level access, to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page. This only affects multi-site installations and installations where unfiltered_html has been disabled.

Action-Not Available
Vendor-wp-eventmanagerwpeventmanager
Product-wp_event_managerWP Event Manager – Events Calendar, Registrations, Sell Tickets with WooCommerce
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2024-0625
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.4||MEDIUM
EPSS-0.19% / 40.95%
||
7 Day CHG~0.00%
Published-25 Jan, 2024 | 02:32
Updated-08 Apr, 2026 | 17:17
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WPFront Notification Bar <= 3.3.2 - Authenticated (Admin+) Stored Cross-Site Scripting via wpfront-notification-bar-options[custom_class]

The WPFront Notification Bar plugin for WordPress is vulnerable to Stored Cross-Site Scripting via the ‘wpfront-notification-bar-options[custom_class]’ parameter in all versions up to, and including, 3.3.2 due to insufficient input sanitization and output escaping. This makes it possible for authenticated attackers, with administrator-level access, to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page. This only affects multi-site installations and installations where unfiltered_html has been disabled.

Action-Not Available
Vendor-wpfrontsyammohanm
Product-wpfront_notification_barWPFront Notification Bar
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2024-0618
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.4||MEDIUM
EPSS-0.13% / 31.73%
||
7 Day CHG~0.00%
Published-27 Jan, 2024 | 05:38
Updated-08 Apr, 2026 | 17:17
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Fluent Forms <= 5.1.5 - Authenticated(Administrator+) Stored Cross-Site Scripting via imported form title

The Contact Form Plugin – Fastest Contact Form Builder Plugin for WordPress by Fluent Forms plugin for WordPress is vulnerable to Stored Cross-Site Scripting via imported form titles in all versions up to, and including, 5.1.5 due to insufficient input sanitization and output escaping. This makes it possible for authenticated attackers, with administrator-level access, to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page. This only affects multi-site installations and installations where unfiltered_html has been disabled.

Action-Not Available
Vendor-fluentformstechjewel
Product-contact_formFluent Forms – Customizable Contact Forms, Survey, Quiz, & Conversational Form Builder
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2024-0614
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.4||MEDIUM
EPSS-0.30% / 54.07%
||
7 Day CHG~0.00%
Published-13 Mar, 2024 | 15:26
Updated-08 Apr, 2026 | 18:18
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Events Manager <= 6.4.6.4 - Authenticated(Administator+) Stored Cross-Site Scripting via settings

The Events Manager plugin for WordPress is vulnerable to Stored Cross-Site Scripting via admin settings in all versions up to, and including, 6.4.6.4 due to insufficient input sanitization and output escaping. This makes it possible for authenticated attackers, with administrator-level permissions and above, to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page. This only affects multi-site installations and installations where unfiltered_html has been disabled.

Action-Not Available
Vendor-pixelitenetweblogic
Product-events_managerEvents Manager – Calendar, Bookings, Tickets, and more!
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2025-5055
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.4||MEDIUM
EPSS-0.16% / 36.99%
||
7 Day CHG~0.00%
Published-24 May, 2025 | 02:23
Updated-08 Apr, 2026 | 18:24
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Smart Forms <= 2.6.98 - Authenticated (Admin+) Stored Cross-Site Scripting

The Smart Forms – when you need more than just a contact form plugin for WordPress is vulnerable to Stored Cross-Site Scripting via admin settings in all versions up to, and including, 2.6.98 due to insufficient input sanitization and output escaping. This makes it possible for authenticated attackers, with administrator-level permissions and above, to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page. This only affects multi-site installations and installations where unfiltered_html has been disabled.

Action-Not Available
Vendor-edgarrojas
Product-Smart Forms – when you need more than just a contact form
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2024-0664
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.4||MEDIUM
EPSS-0.16% / 36.49%
||
7 Day CHG~0.00%
Published-27 Jan, 2024 | 03:32
Updated-08 Apr, 2026 | 18:18
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Meks Smart Social Widget <= 1.6.3 - Authenticated (Admin+) Stored Cross-Site Scripting

The Meks Smart Social Widget plugin for WordPress is vulnerable to Stored Cross-Site Scripting via the Meks Smart Social Widget in all versions up to, and including, 1.6.3 due to insufficient input sanitization and output escaping. This makes it possible for authenticated attackers, with administrator-level access, to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page. This only affects multi-site installations and installations where unfiltered_html has been disabled.

Action-Not Available
Vendor-mekshqmekshq
Product-meks_smart_social_widgetMeks Smart Social Widget
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2024-0612
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.4||MEDIUM
EPSS-0.24% / 46.67%
||
7 Day CHG~0.00%
Published-05 Feb, 2024 | 21:21
Updated-08 Apr, 2026 | 19:19
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Content Views <= 3.6.2 - Authenticated(Administrator+) Stored Cross-Site Scripting via settings

The Content Views – Post Grid, Slider, Accordion (Gutenberg Blocks and Shortcode) plugin for WordPress is vulnerable to Stored Cross-Site Scripting via admin settings in all versions up to, and including, 3.6.2 due to insufficient input sanitization and output escaping. This makes it possible for authenticated attackers, with administrator-level permissions and above, to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page. This only affects multi-site installations and installations where unfiltered_html has been disabled.

Action-Not Available
Vendor-contentviewspropt-guy
Product-content_viewsContent Views – Post Grid & Filter, Recent Posts, Category Posts … (Shortcode, Gutenberg Blocks, and Widgets for Elementor)
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2024-0898
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.4||MEDIUM
EPSS-0.19% / 40.76%
||
7 Day CHG~0.00%
Published-13 Mar, 2024 | 15:27
Updated-08 Apr, 2026 | 19:19
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Chat Bubble <= 2.3 - Authenticated (Administrator+) Stored Cross-Site Scripting

The Chat Bubble – Floating Chat with Contact Chat Icons, Messages, Telegram, Email, SMS, Call me back plugin for WordPress is vulnerable to Stored Cross-Site Scripting via admin settings in all versions up to, and including, 2.3 due to insufficient input sanitization and output escaping. This makes it possible for authenticated attackers, with administrator-level permissions and above, to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page. This only affects multi-site installations and installations where unfiltered_html has been disabled.

Action-Not Available
Vendor-bluecoralbluecoral
Product-chat_bubbleChat Bubble – Floating Chat with Contact Chat Icons, Messages, Telegram, Email, SMS, Call me back
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2024-0632
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.4||MEDIUM
EPSS-0.40% / 61.11%
||
7 Day CHG~0.00%
Published-22 May, 2024 | 07:37
Updated-15 Apr, 2026 | 00:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Automatic Translator with Google Translate <= 1.5.4 - Authenticated (Administrator+) Stored Cross-Site Scripting via Custom Font

The Automatic Translator with Google Translate plugin for WordPress is vulnerable to Stored Cross-Site Scripting via the custom font setting in all versions up to, and including, 1.5.4 due to insufficient input sanitization and output escaping. This makes it possible for authenticated attackers, with administrator-level access, to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page. This only affects multi-site installations and installations where unfiltered_html has been disabled.

Action-Not Available
Vendor-juangirini
Product-Automatic Translator with Google Translate
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2023-6842
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.4||MEDIUM
EPSS-0.17% / 37.87%
||
7 Day CHG~0.00%
Published-09 Jan, 2024 | 06:41
Updated-08 Apr, 2026 | 18:18
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Formidable Forms <= 6.7 - Authenticated (Administrator+) Stored Cross-Site Scripting

The Formidable Forms – Contact Form, Survey, Quiz, Payment, Calculator Form & Custom Form Builder plugin for WordPress is vulnerable to Stored Cross-Site Scripting via the name field label and description field label parameter in all versions up to 6.7 (inclusive) due to insufficient input sanitization and output escaping. This makes it possible for authenticated attackers, with administrator-level access, to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page. By default, this only affects multi-site installations and installations where unfiltered_html has been disabled. However, in the formidable settings admins can extend form creation, deletion and other management permissions to other user types, which makes it possible for this vulnerability to be exploited by lower level user types as long as they have been granted the proper permissions.

Action-Not Available
Vendor-Strategy11
Product-formidable_form_builderFormidable Forms – Contact Form Plugin, Survey, Quiz, Payment, Calculator Form & Custom Form Builder
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2026-9594
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.4||MEDIUM
EPSS-0.03% / 7.54%
||
7 Day CHG~0.00%
Published-06 Jun, 2026 | 03:28
Updated-08 Jun, 2026 | 14:57
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WP Maps <= 4.9.4 - Authenticated (Admin+) Stored Cross-Site Scripting via 'location_messages' Parameter

The WP Maps – Google Maps,OpenStreetMap,Mapbox,Store Locator,Listing,Directory & Filters plugin for WordPress is vulnerable to Stored Cross-Site Scripting via the 'location_messages' parameter in all versions up to, and including, 4.9.4 due to insufficient input sanitization and output escaping. This makes it possible for authenticated attackers, with administrator-level access and above, to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page. Exploitation requires the attacker to hold the custom wpgmp_manage_location capability, which is granted to administrators by default but can be assigned to lower-privileged roles via the plugin's Permissions screen.

Action-Not Available
Vendor-flippercode
Product-WP Maps – Google Maps,OpenStreetMap,Mapbox,Store Locator,Listing,Directory & Filters
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2023-6924
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.4||MEDIUM
EPSS-0.18% / 40.01%
||
7 Day CHG~0.00%
Published-11 Jan, 2024 | 08:32
Updated-08 Apr, 2026 | 17:17
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Photo Gallery by 10Web <= 1.8.18 - Authenticated (Administrator+) Stored Cross-Site Scripting via Widget

The Photo Gallery by 10Web plugin for WordPress is vulnerable to Stored Cross-Site Scripting via widgets in versions up to, and including, 1.8.18 due to insufficient input sanitization and output escaping on user supplied attributes. This makes it possible for authenticated attackers with administrator-level and above permissions to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page. It can also be exploited with a contributor-level permission with a page builder plugin.

Action-Not Available
Vendor-10Web (TenWeb, Inc.)
Product-photo_galleryPhoto Gallery by 10Web – Mobile-Friendly Image Gallery
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2025-2874
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.4||MEDIUM
EPSS-0.24% / 46.53%
||
7 Day CHG~0.00%
Published-03 Apr, 2025 | 07:21
Updated-15 Apr, 2026 | 00:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
User Submitted Posts <= 20241026 - Authenticated (Admin+) Stored Cross-Site Scripting

The User Submitted Posts – Enable Users to Submit Posts from the Front End plugin for WordPress is vulnerable to Stored Cross-Site Scripting via admin settings in all versions up to, and including, 20240319 due to insufficient input sanitization and output escaping. This makes it possible for authenticated attackers, with administrator-level permissions and above, to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page. This only affects multi-site installations and installations where unfiltered_html has been disabled.

Action-Not Available
Vendor-specialk
Product-User Submitted Posts – Enable Users to Submit Posts from the Front End
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2024-0449
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.4||MEDIUM
EPSS-0.44% / 63.67%
||
7 Day CHG~0.00%
Published-13 Mar, 2024 | 15:26
Updated-08 Apr, 2026 | 18:18
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
ArtiBot Free Chat Bot for WordPress WebSites <= 1.1.6 - Authenticated (Admin+) Cross-Site Scripting

The ArtiBot Free Chat Bot for WordPress WebSites plugin for WordPress is vulnerable to Stored Cross-Site Scripting via admin settings in all versions up to, and including, 1.1.6 due to insufficient input sanitization and output escaping. This makes it possible for authenticated attackers, with administrator-level permissions and above, to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page. This only affects multi-site installations and installations where unfiltered_html has been disabled.

Action-Not Available
Vendor-artibotartibot
Product-artibotArtiBot Free Chat Bot for WebSites
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2023-6494
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.4||MEDIUM
EPSS-0.10% / 27.31%
||
7 Day CHG~0.00%
Published-13 Apr, 2024 | 08:41
Updated-08 Apr, 2026 | 18:18
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WPC Smart Quick View for WooCommerce <= 4.0.2 - Authenticated (Administrator+) Stored Cross-Site Scripting

The WPC Smart Quick View for WooCommerce plugin for WordPress is vulnerable to Stored Cross-Site Scripting via admin settings in all versions up to, and including, 4.0.2 due to insufficient input sanitization and output escaping. This makes it possible for authenticated attackers, with administrator-level permissions and above, to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page. This only affects multi-site installations and installations where unfiltered_html has been disabled.

Action-Not Available
Vendor-wpcleverwpcleverwpclever
Product-wpc_smart_quick_view_for_woocommerceWPC Smart Quick View for WooCommercewpc_smart_quick_view_for_woocommerce
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CWE ID-CWE-94
Improper Control of Generation of Code ('Code Injection')
CVE-2023-5621
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.4||MEDIUM
EPSS-0.17% / 37.97%
||
7 Day CHG~0.00%
Published-18 Oct, 2023 | 07:31
Updated-08 Apr, 2026 | 18:18
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Thumbnail Slider With Lightbox <= 1.0 - Authenticated (Administrator+) Stored Cross-Site Scripting via Image Title

The Thumbnail Slider With Lightbox plugin for WordPress is vulnerable to Stored Cross-Site Scripting via the Image Title field in versions up to, and including, 1.0 due to insufficient input sanitization and output escaping. This makes it possible for authenticated attackers, with administrator-level access, to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page. This only affects multi-site installations and installations where unfiltered_html has been disabled.

Action-Not Available
Vendor-i13websolutionnik00726
Product-thumbnail_slider_with_lightboxThumbnail Slider With Lightbox
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2025-2613
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.4||MEDIUM
EPSS-0.24% / 46.53%
||
7 Day CHG~0.00%
Published-18 Apr, 2025 | 01:44
Updated-15 Apr, 2026 | 00:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Login Manager – Design Login Page, View Login Activity, Limit Login Attempts <= 2.0.5 - Authenticated (Administrator+) Stored Cross-Site Scripting via Custom URL

The Login Manager – Design Login Page, View Login Activity, Limit Login Attempts plugin for WordPress is vulnerable to Stored Cross-Site Scripting via Custom logo and background URLs in all versions up to, and including, 2.0.5 due to insufficient input sanitization and output escaping. This makes it possible for authenticated attackers, with administrator-level permissions and above, to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page. This only affects multi-site installations and installations where unfiltered_html has been disabled.

Action-Not Available
Vendor-mehrazmorshed
Product-Login Manager – Design Login Page, View Login Activity, Limit Login Attempts
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2023-6497
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.4||MEDIUM
EPSS-0.12% / 30.48%
||
7 Day CHG~0.00%
Published-27 Jan, 2024 | 03:32
Updated-08 Apr, 2026 | 19:18
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Simple Shopping Cart <= 4.7.1 - Authenticated(Administrator+) Stored Cross-Site Scripting

The WordPress Simple Shopping Cart plugin for WordPress is vulnerable to Stored Cross-Site Scripting via the automatic redirect URL setting in all versions up to and including 4.7.1 due to insufficient input sanitization and output escaping. This makes it possible for authenticated attackers, with administrator-level permissions and above, to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page. This only affects multi-site installations and installations where unfiltered_html has been disabled.

Action-Not Available
Vendor-mra13Tips and Tricks HQ
Product-wordpress_simple_paypal_shopping_cartSimple Shopping Cart
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2023-5691
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.4||MEDIUM
EPSS-0.18% / 39.55%
||
7 Day CHG~0.00%
Published-11 Jan, 2024 | 08:33
Updated-03 Jun, 2025 | 14:15
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

The Chatbot for WordPress plugin for WordPress is vulnerable to Stored Cross-Site Scripting via admin settings in version 2.3.9 due to insufficient input sanitization and output escaping. This makes it possible for authenticated attackers, with administrator-level permissions and above, to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page. This only affects multi-site installations and installations where unfiltered_html has been disabled.

Action-Not Available
Vendor-collect.chatcollectchat
Product-chatbotCollect.chat Chatbot ⚡️
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2023-6446
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.4||MEDIUM
EPSS-0.19% / 41.06%
||
7 Day CHG~0.00%
Published-11 Jan, 2024 | 06:49
Updated-08 Apr, 2026 | 19:18
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Calculated Fields Form <= 1.2.40 - Authenticated (Admin+) Stored Cross-Site Scripting

The Calculated Fields Form plugin for WordPress is vulnerable to Stored Cross-Site Scripting via admin settings in all versions up to, and including, 1.2.40 due to insufficient input sanitization and output escaping. This makes it possible for authenticated attackers, with administrator-level permissions and above, to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page. This only affects multi-site installations and installations where unfiltered_html has been disabled.

Action-Not Available
Vendor-CodePeople
Product-calculated_fields_formCalculated Fields Form
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CWE ID-CWE-87
Improper Neutralization of Alternate XSS Syntax
CVE-2023-5381
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.4||MEDIUM
EPSS-0.17% / 37.63%
||
7 Day CHG~0.00%
Published-15 Nov, 2023 | 22:32
Updated-08 Apr, 2026 | 19:18
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Elementor Addon Elements <= 1.12.7 - Authenticated (Administrator+) Stored Cross-Site Scripting

The Elementor Addon Elements plugin for WordPress is vulnerable to Stored Cross-Site Scripting via admin settings in versions up to, and including, 1.12.7 due to insufficient input sanitization and output escaping. This makes it possible for authenticated attackers, with administrator-level permissions and above, to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page. This only affects multi-site installations and installations where unfiltered_html has been disabled.

Action-Not Available
Vendor-webtechstreetwpvibes
Product-elementor_addon_elementsAddon Elements for Elementor (formerly Elementor Addon Elements)
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2023-4726
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.4||MEDIUM
EPSS-0.14% / 33.32%
||
7 Day CHG~0.00%
Published-22 Nov, 2023 | 15:33
Updated-08 Apr, 2026 | 18:18
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Ultimate Dashboard <= 3.7.7 - Authenticated (Administrator+) Stored Cross-Site Scripting via plugin settings

The Ultimate Dashboard plugin for WordPress is vulnerable to Stored Cross-Site Scripting via admin settings in versions up to, and including, 3.7.7. due to insufficient input sanitization and output escaping. This makes it possible for authenticated attackers, with administrator-level permissions and above, to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page. This only affects multi-site installations and installations where unfiltered_html has been disabled.

Action-Not Available
Vendor-davidvongriesdavidvongries
Product-ultimate_dashboardUltimate Dashboard – Custom WordPress Dashboard
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2026-7421
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.4||MEDIUM
EPSS-0.04% / 13.82%
||
7 Day CHG+0.01%
Published-02 Jun, 2026 | 23:27
Updated-04 Jun, 2026 | 13:53
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Passeum Ticketing <= 1.0 - Authenticated (Administrator+) Stored Cross-Site Scripting via 'shop_name' Setting

The Passeum Ticketing plugin for WordPress is vulnerable to Stored Cross-Site Scripting in all versions up to, and including, 1.0. This is due to the `get_shop_url()` method returning the `shop_name` setting value without sanitization when it begins with "http", combined with insufficient validation in the `validate_shop_name()` function which only checks for empty values and string type. This makes it possible for authenticated attackers, with Administrator-level access and above, to inject arbitrary external scripts by setting the `shop_name` to an attacker-controlled URL (e.g., `https://attacker.com`), which causes the plugin to enqueue external JavaScript and CSS from the attacker-controlled domain via `wp_register_script()` and `wp_register_style()`. The injected scripts execute on every frontend page containing any Passeum Ticketing shortcode, affecting all site visitors. Please note that this does not affect single-site installations as administrators already have the `unfiltered_html` capability.

Action-Not Available
Vendor-passeum
Product-Passeum Ticketing
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2023-4271
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.4||MEDIUM
EPSS-0.15% / 35.72%
||
7 Day CHG~0.00%
Published-20 Oct, 2023 | 06:35
Updated-08 Apr, 2026 | 18:18
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Photospace Responsive <= 2.1.1 - Authenticated (Administrator+) Stored Cross-Site Scripting

The Photospace Responsive plugin for WordPress is vulnerable to Stored Cross-Site Scripting via the ‘psres_button_size’ parameter in versions up to, and including, 2.1.1 due to insufficient input sanitization and output escaping. This makes it possible for authenticated attackers, with administrator-level permissions and above, to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page. This only affects multi-site installations and installations where unfiltered_html has been disabled.

Action-Not Available
Vendor-deanoakleydeanoakley
Product-photospace_responsive_galleryPhotospace Responsive Gallery
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2023-4021
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.4||MEDIUM
EPSS-0.17% / 38.10%
||
7 Day CHG~0.00%
Published-20 Oct, 2023 | 07:29
Updated-08 Apr, 2026 | 19:18
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Modern Events Calendar lite < 7.1.0 - Authenticated (Admin+) Stored Cross-Site Scripting

The Modern Events Calendar lite plugin for WordPress is vulnerable to Stored Cross-Site Scripting via Google API key and Calendar ID in versions up to, but not including, 7.1.0 due to insufficient input sanitization and output escaping. This makes it possible for authenticated attackers, with administrator-level permissions and above, to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page. This only affects multi-site installations and installations where unfiltered_html has been disabled.

Action-Not Available
Vendor-webnuswebnus/
Product-modern_events_calendar_liteModern Events Calendar Lite
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2025-13682
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.4||MEDIUM
EPSS-0.02% / 5.91%
||
7 Day CHG~0.00%
Published-05 Dec, 2025 | 09:27
Updated-08 Apr, 2026 | 17:31
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Trail Manager <= 1.0.0 - Authenticated (Admin+) Stored Cross-Site Scripting

The Trail Manager plugin for WordPress is vulnerable to Stored Cross-Site Scripting via admin settings in all versions up to, and including, 1.0.0 due to insufficient input sanitization and output escaping. This makes it possible for authenticated attackers, with administrator-level permissions and above, to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page. This only affects multi-site installations and installations where unfiltered_html has been disabled.

Action-Not Available
Vendor-phegman
Product-Trail Manager
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2025-12451
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.4||MEDIUM
EPSS-0.04% / 12.16%
||
7 Day CHG~0.00%
Published-19 Feb, 2026 | 03:25
Updated-08 Apr, 2026 | 18:23
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Easy SVG Support <= 4.0 - Authenticated (Author+) Stored Cross-Site Scripting via SVG File Upload

The Easy SVG Support plugin for WordPress is vulnerable to Stored Cross-Site Scripting via SVG file uploads in all versions up to, and including, 4.0 due to insufficient input sanitization and output escaping. This makes it possible for authenticated attackers, with Author-level access and above, to inject arbitrary web scripts in pages that will execute whenever a user accesses the SVG file.

Action-Not Available
Vendor-benjamin_zekavica
Product-Easy SVG Support
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2023-3369
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.4||MEDIUM
EPSS-0.15% / 34.82%
||
7 Day CHG~0.00%
Published-12 Jul, 2023 | 04:38
Updated-08 Apr, 2026 | 19:18
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
About Me 3000 widget <= 2.2.6 - Authenticated (Administrator+) Stored Cross-Site Scripting

The About Me 3000 widget plugin for WordPress is vulnerable to Stored Cross-Site Scripting via admin settings in versions up to, and including, 2.2.6 due to insufficient input sanitization and output escaping. This makes it possible for authenticated attackers, with administrator-level permissions and above, to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page. This only affects multi-site installations and installations where unfiltered_html has been disabled.

Action-Not Available
Vendor-wpmaniaxd3wp
Product-about_me_3000About Me 3000 widget
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2023-4160
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.4||MEDIUM
EPSS-0.15% / 35.93%
||
7 Day CHG~0.00%
Published-31 Aug, 2023 | 05:33
Updated-08 Apr, 2026 | 18:18
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WooCommerce PDF Invoice Builder <= 1.2.90 - Authenticated (Administrator+) Cross-Site Scripting

The WooCommerce PDF Invoice Builder plugin for WordPress is vulnerable to Stored Cross-Site Scripting via admin settings in versions up to, and including, 1.2.90 due to insufficient input sanitization and output escaping. This makes it possible for authenticated attackers, with administrator-level permissions and above, to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page. This only affects multi-site installations and installations where unfiltered_html has been disabled.

Action-Not Available
Vendor-rednaoedgarrojas
Product-woocommerce_pdf_invoice_builderPDF Builder for WooCommerce. Create invoices,packing slips and more
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2025-14467
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.4||MEDIUM
EPSS-0.03% / 9.65%
||
7 Day CHG~0.00%
Published-12 Dec, 2025 | 03:20
Updated-08 Apr, 2026 | 17:20
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WP Job Portal <= 2.4.4 - Authenticated (Editor+) Stored Cross-Site Scripting via Job Description Field

The WP Job Portal plugin for WordPress is vulnerable to Stored Cross-Site Scripting in all versions up to, and including, 2.4.4. This is due to the plugin explicitly whitelisting the `<script>` tag in its `WPJOBPORTAL_ALLOWED_TAGS` configuration and using insufficient input sanitization when saving job descriptions. This makes it possible for authenticated attackers, with Editor-level access and above, to inject arbitrary web scripts into job description fields via the job creation/editing interface. These scripts will execute whenever a user accesses an injected page, enabling session hijacking, credential theft, and other malicious activities.This only impacts multi-site installations, or those with unfiltered_html disabled.

Action-Not Available
Vendor-WP Job Portal
Product-WP Job Portal – AI-Powered Recruitment System for Company or Job Board website
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CVE-2025-15021
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.4||MEDIUM
EPSS-0.04% / 12.11%
||
7 Day CHG~0.00%
Published-14 Jan, 2026 | 05:28
Updated-08 Apr, 2026 | 19:23
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Gotham Block Extra Light <= 1.5.0 - Authenticated (Administrator+) Stored Cross-Site Scripting via Plugin Settings

The Gotham Block Extra Light plugin for WordPress is vulnerable to Stored Cross-Site Scripting via admin settings in all versions up to, and including, 1.5.0 due to insufficient input sanitization and output escaping. This makes it possible for authenticated attackers, with administrator-level permissions and above, to inject arbitrary web scripts in pages that will execute whenever a user accesses an injected page. This only affects multi-site installations and installations where unfiltered_html has been disabled.

Action-Not Available
Vendor-gothamdev
Product-Gotham Block Extra Light
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
  • Previous
  • 1
  • 2
  • 3
  • 4
  • 5
  • 6
  • Next
Details not found