Logo
-

Byte Open Security

(ByteOS Network)

Log In

Sign Up

ByteOS

Security
Vulnerability Details
Registries
Custom Views
Weaknesses
Attack Patterns
Filters & Tools

Domain Mapping System | Create Microsites with Multiple Alias Domains (multisite optional)

Source -

CNA

CNA CVEs -

1

ADP CVEs -

0

CISA CVEs -

0

NVD CVEs -

0
Related CVEsRelated VendorsRelated AssignersReports
1Vulnerabilities found

CVE-2022-4974
Assigner-Wordfence
ShareView Details
Assigner-Wordfence
CVSS Score-6.3||MEDIUM
EPSS-0.21% / 42.91%
||
7 Day CHG~0.00%
Published-16 Oct, 2024 | 06:43
Updated-15 Apr, 2026 | 00:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Freemius SDK <= 2.4.2 - Missing Authorization Checks

The Freemius SDK, as used by hundreds of WordPress plugin and theme developers, was vulnerable to Cross-Site Request Forgery and Information disclosure due to missing capability checks and nonce protection on the _get_debug_log, _get_db_option, and the _set_db_option functions in versions up to, and including 2.4.2. Any WordPress plugin or theme running a version of Freemius less than 2.4.3 is vulnerable.

Action-Not Available
Vendor-pasyukdavidandersonwpchillmohsinofflinevincoitjanwylmohammedrezqjcodexversacompdiviframeworkwpvibeslistplustickerawpsaadgalooverproteusthemestripettodangub86mantrabrainpowerfulwpwebmuehlecloudspongeblackandwhitedigitaltauhidpromasterblocksbfintalivanchernyakovfrostbournboriscolombier/cmbibby/bestpluginswordpressnitin247creativethemeshqkaizencoderskartikparmartprintyedisonavehumblethemesdovypavidthemes/paulio21patrickgarmanibenicbeeneebchillichallicebbiwphrmanagerekanathjburleigh1uriahs-victorfsruslanmcurlyggriessermojofywpblockypagewpjolielbisnerohqthemeroyalnavneetxyulexsakurapixeldjenhcodexonicsinterfacelabelementinvaderatakanozfoxmooncypressnorthpluginswareupfivgallerycreatorjurskiinfosatechthemeseidudoco2okoceanwpwpgeniuzcommercepunditelliotvslostboy7sslatlasdejanmarkovicggeddesmartwpresskhothemesblocksparesovstackseezeelinekaldgwyermatstarswpscriptsdashlabsltdequalizedigitalbpluginsgloriousthemesw3scloudnasirahmedwiserstepsejslondon/melapressjavmahmulticollabcodesavorywpdeliciousmajickmdedevdotsdaigo75wpeka-clubedgegallerypluginsyntacticsnpluginscodeieswpbitsmoomooagencyhalmatahmed17wpdeverimtiazrayhanattestgreenjaymediacadudecastroalvespeterschulznlsindyakinsergeisurbmaninjalibspluginandplaymodulemastersrisethemeprotectyouruploadswpconedevzeethemecoderpresssslzensebettoddhalfpennymarviorochasonalsinha21vohotv/webba-agencystaxwpvernaltheafricanbossactuaryzaskmihail-barinovoloyede-jamiuldninjas/cloudlivingstarfishwpmnelson4intoxstudiostreamweaselsdipcodevinod-dalviprasadkirpekarlynn999getsparrowthemekraftmajick/pmbaldhathemelocationultradevspootlepressanfrageformulardotrexsvovafwp-makingpenguininitiativeshiddenpearlsolezhyk5patrickposnerzerozendesignstylingwebbenrenaudbodwpmagicsethereumicoiomaurolopes/flexithemeswpmunichtherealwebdisruptanasbinmukimalex-yelkoudalbenmoreassyntalexmosskenanfalloninputwpstevejburgematthias-reuteroceaskairamumarym1985koen12344wordplusrafacarvalhidowupowplegalpagesjanthielemanntribalnerdcleverpluginsweconnectcodepagebuildersandwichproperfractionrichard-bboltonstudiostheafricanboss/kartikparmar/pippozanardomeowcrewmaciejbak85jwebsolsj_oxplodedthemesdamian-gorajamesparkninjadanielisersalttechnomaltathemesdivisumostevehentywpkubewpmoosekylegilmanaharonyanmberdingwptbmattpramschufertonyzeolisjavedtranzlyivacylitonice13samdaniakdevsblockmeistermarcqueraltsebet/wpsoulthijziebilaltasdanielealessandraskymindsslidedeckkartechifywptravelengineaguilerasoftmte90jetixwpvanyukovspartacskshaikatwpeventpartners/samuelsilvaptpremmerceandyabelowdarelljkohlbachclickervolttakanakuipopeatingrebelcodelukeseagereedeefullworkssmgteambrandonfirelivemeshwpdiveusmanaliqureshithemeythemesirkanupmbaldha/badhonrockskkikuchi1220bouncingsproutinvisnetanssilaitiladam6plwebheadllcwgaugegowebsmartywpt00lsgiladtakoniwpengineessekiaprinceahmedwoodyhaydaybycrikmeepluginsfoopluginsmikebelsmuhammad-rehmansorsawojaydeep-nimavatglowlogixmaartenbelmansdanish-alironena100gkher/dreamfoxbrightvesseldevthemestyalleythemesalekvjohnc1979xjohnykcliffpaulickpassionatebrainsmunirkamalsetkawoopopsshelob9maxsdesignggwiczivan_paulinmhmrajibwpcohort/bavokoservicesdaniyalahmedkfrenifyalphabposervicembrown24deothemestropicalistalimbcodedvizheniawhiteshadowgfiremh3technologiestobias_conradcromer12cyberhobomikewire_rocksolidthinleekmilukove/closemarketing/shawoninfokitthemesthecodechimemilmorrankbearshamim51shabtisaadiqbalultimateblockskrspwalkerwpswitcorpwordpresschefunitecmsclosetechnologyinteractivegeomapsankitmaruannastaaiksstudiomilukovewpcohortseancarricosangaranjwindtobias_conrad/pagup9brada6buttonizerpootlepress/plugins360kaggdesignmvvapps/fastaf/scrollsequence5starpluginsdrosendosnazzythemesprelcchetmacrafalosinskibandidojosevegainfornwebwpdevpowersnicheaddonsBdThemesRoyal Elementor AddonsThe Events Calendar (StellarWP)WPWeb EliteThemeisle
Product-annasta Filters for WooCommerceBattle Suit for DiviBetter Robots.txt – AI-Ready Crawl Control & Bot GovernanceStyler Mate for Contact Form 7eaSYNC Booking – Hotels, Restaurants & Car RentalsWidget Detector for ElementorTickera – Sell Tickets & Manage EventsBlock Slider – Responsive Image Slider, Video Slider & Post SliderGloriousThemes Starter SitesGateway for PayLate on WooCommerceUltimate Post Kit Addons for ElementorDivi Content RestrictorLivemesh Addons for Beaver BuilderWidgets on Pages and PostsEvent Tickets and RegistrationWP Page TemplatesAutoSave NetAWCA – The Great Analytics Insights for Your eStoreWebinarIgnition – Live, Automated & Evergreen Webinars for WooCommerceInsert or Embed Articulate Content into WordPressForm Vibes – Database Manager for FormsQuick Contact FormLocal Delivery Drivers for WooCommerceAddon Elements for Elementor (formerly Elementor Addon Elements)Media Cloud for Bunny CDN, Amazon S3, Cloudflare R2, Google Cloud Storage, DigitalOcean and moreMenu Item SchedulerExpire tagsAdd Pinterest conversion tags for Pinterest Ads + Site verificationGA4WP – Analytics Dashboard for the WebsiteHM Multiple RolesWP Search FilterPlace Order Without Payment for WooCommerceBookPress – For Book AuthorsMusic Player for Elementor – Audio Player & Podcast PlayerPost Form – Registration Form – Profile Form for User Profiles – Frontend Content Forms for User Submissions (UGC)Bulk Attachment DownloadWordPress Dev Powers – ACF Color Coded Field Types PluginPost Carousel DiviWP Google Street View (with 360° virtual tour) & Google maps + Local SEOAutomatic Internal Links for SEO by PagupEasy Post Views CountAdvanced Page Visit Counter – Most Wanted Analytics Plugin for WordPressWordPress Gallery Plugin – Edge Photo GalleryBulk WooCommerce Category CreatorBooking Addon for WooCommerceEasy PrayerUkrposhtaPremmerce Variation Swatches for WooCommerceThe Events CalendarTK Google Fonts GDPR CompliantGuest posting / Frontend Posting / Front Editor – WP Front User SubmitDuplicate Variations for WoocommerceCF7 Constant Contact Fields MappingGeo MashupReplyable – Subscribe to Comments and Reply by EmailWP Photo EffectsMenu Image, Icons made easyAwesome SSLFiboSearch – Ajax Search for WooCommerceProduct Image Watermark for WooBetter SharingPremmerceRT Easy Builder – Advanced addons for ElementorAll-in-One Video GalleryTinyMCE AnnotateKVoucherWP fail2ban – Advanced SecurityDa ReactionsPayment Gateway for PayFabricNotification Bar, Announcement and Cookie Notice WordPress Plugin – FooBarNotifSMS – SMS Notifications OTP & 2FA for WordPress & WooCommerceWP Easy Pay – Payment and Donation form Builder for SquareConversion de moneda WoocommerceCustomers Table for WooCommerce: View, Search, Bulk EditorSchema Plugin For Divi, Gutenberg & ShortcodesMaster Accordion ( Former WP Awesome FAQ Plugin )Masonry Gallery & Posts For Divi (WP Tools)Blocksy CompanionRoyal Addons for Elementor – Addons and Templates Kit for ElementorBlockSpare — News, Magazine and Blog Addons for (Gutenberg) Block EditorWP Get PersonalPost Slider and Post Carousel with Post Vertical Scrolling Widget – A Responsive Post SliderGet Better Reviews for WooCommerceInbound BrewSimple Feature Requests Free – User Feedback BoardAnfrageformular – Multi Step Drag & Drop Formular Builder – LeadgenerierungEqualize Digital Accessibility Checker – WCAG, ADA, EAA and Section 508 complianceWordPress Coupon Plugin for Bloggers and Marketers – WP OffersEasy Code SnippetsDeMomentSomTres AddressDeMomentSomTres Media Tools AutoMarket ExporterWP GratifyHQTheme ExtraSlideDeck: Responsive WordPress Slider PluginMulti Page Auto Advance for Gravity FormsWP BugBotDeals of the Day WooCommercebbResolutionsSmart Variations Images & Swatches for WooCommercePremmerce Wishlist for WooCommerceRevolution for ElementorEasy Social Feed – Social Photos Gallery and Post Feed for WordPressPayment Gateway Per Product for WooCommerceWP Notification BellHelpie FAQ — Accordion, Docs & Knowledge BaseFrontend group restriction for LearnDashWidgets for WooCommerce Products on ElementorNugget by Ingot: Easy, automated and native A/B testing for everyoneGreenshift – animation and page builder blocksSTEWoo – Super Transactional Emails for WooCommerceThe best plugin for restrict content, support all Custom Post Types and Elementor – Password ProtectedFlat Rate Shipping Method for WooCommerceSimple Sitemap – Create a Responsive HTML SitemapClickerVolt – Affiliate Links & Click Tracking for Performance MarketersWooCommerce Next Order CouponNEXUSCAPTCHA 4WP – Antispam CAPTCHA solution for WordPressWP Relevant AdsIks Menu – WordPress Category Accordion Menu & FAQsWP Data Access – App Builder for Tables, Forms, Charts, Maps & DashboardsMarijuana Age VerifyWooCommerce upcoming ProductsEvents Calendar RegistrationChoice Payment Gateway for WooCommerceFilr – Secure document libraryWOW Styler for CF7 – Visual Styler for Contact Form 7 FormsPage Builder Sandwich – Front End WordPress Page Builder PluginBetter Addons for ElementorCuisine PalaceSVG Flags – Beautiful Scalable Flags For All Countries!VidSEO – Video transcript embedding for WordPress & LLMRating-Widget: Star Review SystemCryptocurrency Product for WooCommerceNew User ApproveUnakitGo Fetch Jobs (for WP Job Manager)Pixel Manager for WooCommerce – Conversion Tracking, Google Ads, GA4, TikTok, Dynamic RemarketingAutomizy Gravity FormsRaCar Clear Cart for WooCommerceWP-HR Manager: The Human Resources Plugin for WordPressReally Simple Featured Video – Featured Video Support for Posts, Pages & WooCommerce ProductsWordPress Auto SEO Plugin – Upfiv SEO WizardCookie Banner for GDPR / CCPA – WPLP Cookie ConsentFunnelmentalsShipping Gateway Per Product for WooCommerceDeMomentSomTres Grid ArchiveLicense Manager for WooCommerceVit Website ReviewsLawPress – Law Firm Website ManagementSpeculorAquarella LiteJoli Table Of ContentsWP Travel Engine – Tour Booking Plugin – Tour Operator SoftwareReset Course Progress For LearnDashResponsive Social Slider WidgetNitek Carousel Slider Cool TransitionsNumber ChatStreamWeasels Twitch IntegrationTreePress – Easy Family Trees & Ancestor ProfilesEvents Addon for ElementorContact List – Online Staff Directory & Address BookProtect Uploads with Login – Protect Your UploadsFrontend Admin by DynamiAppsWholesale for WooCommerceFull Page Blog DesignerAgy – Age verification for WooCommerceEthereumICOFuse Social Floating SidebarMOBILOOK — Mobile View & Mobile‑Friendly TestServer InfoCategorify – WordPress Media Library Category & File ManagerWUPO Group Attributes for WooCommerceLMS Plugin – eLearning, Online Courses by AttestMixed Media Gallery BlocksWordPress Slider Block GutensliderBlog Sidebar WidgetOcean ExtraNicheTable – Responsive Comparison Table BlockGlossaryConeBlog – Elementor Blog WidgetsXT Floating Cart for WooCommerceAEH Speed Optimization: Browser Cache, Optimized Minify, Lazy Loading & Image OptimizationUnder ConstructionElationAll in One Invite CodesLittleBot InvoicesUltra Elementor AddonsCustom Registration and Custom Login Forms with New RecaptchaMedia Library File DownloadSecure IP LoginsDomain Mapping System | Create Microsites with Multiple Alias Domains (multisite optional)Team Members – A WordPress Team Plugin with Gallery, Grid, Carousel, Slider, Table, List, and MoreClean Social IconsCoupon Affiliates – Affiliate Plugin for WooCommerceCountry Based Payments for WooCommerceFooter Plugin for DiviImage Carousel For DiviAge Verification Screen for WooCommerceDelivery for WooCommercePrice Bands for WooCommercePootle Pagebuilder – WordPress Page builderSEO Audit – WP Site AuditorSocial Gallery LiteContact Form 7 – Capsule CRM – IntegrationEverseCustom Login Page CustomizerRun time Image resizingBookit — Booking & Appointment CalendarFive-Star Ratings ShortcodeWordPress Everse Starter Sites – Elementor TemplatesSurveyFunnel – Survey Plugin for WordPressGutenberg Blocks – ACF Blocks SuiteWP Disable SitemapPro Broken Links MaintainerCustom WooCommerce Checkout Fields EditorAdd Tiktok Pixel for Tiktok ads (+Woocommerce)Security SafeFeedpress Generator – External RSS Frontend CustomizerModern Designs for Gravity FormsACF for WooCommerce ProductFile Manager for Google Drive – Integrate Google DriveAirpressDynamic Pricing and Discount Rules for WooCommerceBetter Messages – Integration for WC Vendors MarketplaceLightbox & Modal Popup WordPress Plugin – FooBoxDancePress (TRWA)SKT Templates – 100% Free Templates for Elementor & GutenbergAdvanced Classifieds & Directory ProListPlus – Unlimited Listing DirectoryUltimate Widgets LightPanorama – 360 Virtual Tour, Panoramic image viewer and MoreUltimeterQyrr – simply and modern QR-Code creationChange Price Title for WooCommerceCheckout with Cash App on EDDSV Tracking ManagerPodcast Box – Best Podcasting Plugin for WordPressElements for LifterLMSPassster – Password Protect Pages and ContentVillarAds.txt & App-ads.txt Manager for WordPressEasy Smooth Scroll Links – Smooth Scrolling AnchorLocalSEOMapWordPress form builder plugin for contact forms, surveys and quizzes – TripettoBlock, Suspend, Report for BuddyPressAdd Twitter Pixel for Twitter adsPremmerce Multi-currency for WoocommerceXT Quick View for WooCommercePrimary Addon for ElementorClimateClick: Climate Action for allFocus on Reviews for WooCommerceFeatured Images in RSS for Mailchimp & MoreSEO BoosterPremmerce Product Filter for WooCommerceBook BuyBack PricesWPGSI: Spreadsheet IntegrationSSL Atlas – Free SSL Certificate & HTTPS Redirect for WordPressWP Group PromoterFast WordPressPost Snippets – Custom WordPress Code Snippets CustomizerImage Alt Text Manager – Bulk & Dynamic Alt Tags For image SEO Optimization + AIActivity Log For MainWPHasiumBlocked in China | Check if your site is available in the Chinese mainlandElastaFeatured Products First for WooCommerce – A Extension of WooCommerce (WooCommerce Addon Plugin)Display Eventbrite EventsWP Affiliate DisclosureRestaurant & Cafe Addon for ElementorTeam Collaboration & Content Workflow Plugin for WordPress Editorial Teams – MulticollabWordPress Animation Plugin – Animated EverythingWP Encryption – One Click Free SSL Certificate & SSL / HTTPS Redirect, Security & SSL ScanContact Form 7 Multi-Step FormsWoocommerce Customer Reviews with Artificial Intelligence analyzis, with IBM Watson Tone AnalyzerPower Ups for ElementorWP Lead StreamVideopackWordPress Translation plugin for Post, Pages & WooCommerce products. Tranzly IO AI DeepL automatic WordPress Translator.Auto SEO META keywords (META tags keywords) optimization + WooCommerceBulk Edit Coupons for WooCommerce – WP Sheet EditorWooCommerce PayPlugRW Divi Unite GalleryWP Tools Divi Product CarouselQuick Affiliate StorePremmerce Permalink Manager for WooCommercePremmerce WooCommerce Customers ManagerWP Sessions Time Monitoring Full AutomaticWP Dev Powers – Display Screen Dimensions to Admin PluginAbeta Link PunchOutScrollsequence – Cinematic Scroll Image Animation PluginPremmerce Redirect ManagerYT Player – Embed and Customize Video PlayersPremmerce Wholesale Pricing for WooCommerceDelete Duplicate Postskk Star Ratings – Rate Post & Collect User FeedbacksDelete Posts automaticallyDrip Feed Content Extended for LearndashMaster Blocks – Gutenberg Site BuilderStation Pro – Advanced Audio Streaming & Player for WordPressWordPress SEO ChecklistOverlay Image Divi ModuleAnt Admin Notices for TeamAmelaSuper Video player – Fully Customizable Video Player with PlaylistWP Conference ScheduleEasy Math Captcha for CF7OpenseaXT Ajax Add To Cart for WooCommerceTiered Pricing Table for WooCommerceBulk Auto Image Alt Text (Alt tag, Alt attribute) optimizer (image SEO)Code ManagerWidget for Contact form 7StoreCustomizer – A plugin to Customize all WooCommerce PagesPopOverXYZ – Show Light Weight Beautiful Tool Tips On Any TextProduct Author for WooCommerceMaster Addons For Elementor – Widgets, Extensions, Theme Builder, Popup Builder & Template KitsPurusCaxton – Create Pro page layouts in GutenbergSalon Booking System – Free VersionWP School CalendarQuick Event ManagerWP Meta and Date RemoverTopNewsWp – Display Tikcer News, RSS Feed Widget and Many MoreWordPress Google TranslateAFI – The Easiest Integration PluginVO Store Locator – WP Store Locator PluginWS BootstrapPast Events ExtensionEasy Appointment Booking & Scheduling System – Webba Booking CalendarMultisite Robots.txt ManagerWPOptin – AI-Powered Top Bars, PopUps & Lead GenerationBlog Designer Pack – Blog, Post Grid, Post Slider, Post Carousel, Category Post, NewsShare This ImageRedirection for Contact Form 7Education Addon for ElementorShubanChat Button- Leads and Order over ChatAutomatic YouTube GalleryGenealogical Tree – Family Tree & Ancestry for WordPressWP Frontend ProfileGet feedback from visitors – WP Feedback Suite PluginInternal Link Juicer: SEO Auto Linker for WordPresswGauge – Free VersionViralikeSocialMark – Easy Watermark/Logo on Social Media Post Link Share PreviewImpexium Single Sign OnURL Shortify – Simple and Easy URL ShortenerTablesome Table – Contact Form DB – WPForms, CF7, Gravity, Forminator, FluentBlockMeister – Block Pattern BuilderFAQ Manager For Divi, Gutenberg Block & ShortcodeHooked Editable ContentPowerFolio – Portfolio & Image Gallery for ElementorRadio Player – Live Shoutcast, Icecast and Any Audio Stream PlayerPreloader for DiviError Log MonitorLive Drag and Drop Builder for Contact Form 7Better Messages – Live Chat, Chat Rooms, Real-Time Messaging & Private MessagesPremmerce User RolesWordPress Dev Powers – Element Selector jQuery Powers PluginDivi Gravity Forms (WP Tools)WordPress WooCommerce Sync for Google SheetPurosaWP MooseWP Activity LogComments Not Replied ToPledged Plugins Secure Gateway for Authorize.net and WooCommerceWP Table Builder – Drag & Drop Table BuilderAdvanced Database ReplacerEthPress – Web3 LoginTarot Card OracleGFireM Action AfterNokkeChange Prices with Time for WooCommerceSnazzyAdmin WP Admin ThemeModern Addons for Elementor Page BuilderHuCommerce | Magyar kiegészítések WooCommerce webáruházakhozSend Prebuilt EmailsAlley Business ToolkitProduct Attachment for WooCommercejav's – WooCommerce and Trello integration WooTrelloOrder and Inventory Manager for WooCommerceWalker CorePremmerce Product Search for WooCommerceSync eCommerce NEOUltimate Divi Modules Suite – Divi Sumo LiteWP Books Gallery – Build Stunning Book Showcases & Libraries in MinutesZip Code RedirectSurbma | GDPR Proof Cookie Consent & Notice BarProduct Options and Price Calculation Formulas for WooCommerce – Uni CPOProduct Customer List for WooCommerceStop Contact Form 7 Spam & WPForms Spam – Free ProtectionEasy Newsletter SignupsRest Routes – Custom Endpoints for WordPress REST APIBulk Edit Categories and Tags – Create Thousands Quickly on the EditorCP Simple NewsletterMeridiaSimple Social Page Widget & ShortcodeAidWP – Donation & Payment Forms (Stripe Powered)Multipurpose Gutenberg BlockBulk Edit Posts and Products in SpreadsheetWP Free SSLStreak CRM For Gmail For Contact Form 7 – WordPress PluginLivemesh SiteOrigin WidgetsRun Contests, Raffles, and Giveaways with ContestsWPFrontend Admin – Add and edit posts, pages, users and more all from the frontendCourt Reservation – Manage Your Court Bookings OnlineWordPress Directory Plugin For Business Listings – WP Local PlusEnhanced Ecommerce Google Analytics for WooCommerceKnowledge Base documentation & wiki plugin – BasePress DocsAtlas – Knowledge BaseWP Author BioUltimate Carousel For DiviWoocommerce Customers Order HistoryStore Toolkit – WooCommerce Extensions, Quick Enhancements & Handy ToolsBrandAny Popup – Popup Forms, Optins & AdsAdvanced Menu Manager Pro – Built for Content-heavy WordPress Sites to Add, Filter, Lock, and Edit Menus EasilySticky add to cart for WooWP EmailyEU VAT Assistant for WooCommerceLittleBot ACH for Stripe + PlaidWPMailer – The best mail builder, No More Core for your emails support Elementor, CF7 forms etc…TwentyFourth WP ScraperSocial KitButtonizer – Floating Menus, Sticky Buttons, & Popup BuilderFast Checkout for WooCommerceBanner Management, Product Slider, Product Carousel for WooCommerceBlockyPage – Gutenberg Based Page BuilderEthereum WalletPage Builder for Gutenberg – StarterBlocksGFireM Advance SearchRadio Station by netmix® – Manage and play your Show Schedule in WordPress!JDs PortfolioContent Aware Sidebars – Fastest Widget Area PluginCartPops – High Converting Add To Cart Popup For WooCommerceBuilder for WooCommerce product reviews shortcodes – ReviewShortQuick Paypal PaymentsOne Click LoginRestrict – membership, site, content and user access restrictions for WordPressDrop Shadow BoxesNicheBaseYatri ToolsBAVOKO SEO Tools – All-in-One WordPress SEOPremmerce SEO for WooCommerceRevivePress – Keep your Old Content EvergreenCartoon UrlBlock Styler For Gravity FormsStrumenti Partita IVA per WoocommerceSheetPress – Manage WordPress Meta data with Google SheetsProduct Size Charts Plugin for WooCommerceExtend Filter Products By Price WidgetEasy TikTok Feed – TikTok Video, Feed & Gallery PluginPost List Designer – Category Post, Recent Post, Post ListWP Coupons and Deals – Coupon Plugin For Affiliate MarketersGiveaways for woocommerceMass Pages/Posts CreatorUser Menus – Nav Menu VisibilityPage Builder Gutenberg Blocks – Kioken BlocksPrime Mover – Migrate WordPress Website & BackupsSSL Zen — SSL Certificate Installer & HTTPS RedirectsWPBITS Addons For Elementor Page BuilderLive TV Player – Worldwide Live TV Channels Player for WordPressDigital Goods (Checkout Field Editor) for WooCommerce CheckoutBaniSky Login RedirectWP Delicious – Recipe Plugin for Food Bloggers (formerly Delicious Recipes)Connect WooCommerce Shop to ERP/CRM, Verifactu and EU/VAT ComplianceWPVisitorInfo – Show Visitor Information & Conditional Data Based On That InformationStackable – Page Builder Gutenberg BlocksAvailability Datepicker – Booking Calendar for Contact Form 7 – Input WPGenerate Images (AI) – Magic Post ThumbnailGrid & Styler For Contact Form 7 And DiviYASR – Yet Another Star Rating Plugin for WordPressPay For Post with WooCommerceWP SPID ItaliaEther and ERC20 tokens WooCommerce Payment GatewayRestrict User Access – Ultimate Membership & Content ProtectionNinja Libs Amazon SESMailChimp ManagerGallery by FooGallerySQL Reporting Services – SSRS Plugin for WordPressSimple SponsorshipsWoo Admin Product NotesWC Shop Sync – Square Payment Gateway and Product Synchronization for WooCommerceProduct Carousel For WooCommerce – WoorouSellPostcode RedirectFullscreen MenuBulk Edit and Create User Profiles – WP Sheet EditorXT Variation Swatches for WooCommerceDocument Viewer – Embed Word, Excel, PowerPoint & PDFs InstantlyPrime Slider – Addons for ElementorPremmerce Brands for WooCommerceWP Adminify – White Label WordPress, Admin Menu Editor, Login CustomizerJoli FAQ SEO – WordPress FAQ PluginWP Tools Divi Blog CarouselUltimate Gutenberg – Custom Block TemplatesDivi Torque Lite – Divi Theme, Divi Builder & Extra ThemeCodeKit – Custom Codes EditorAPPExperts – Mobile App Builder for WordPress | WooCommerce to iOS and Android AppsFIT: Featured Image ToolkitConnected SermonsKikote – Location Picker at Checkout & Google Address AutoFill Plugin for WooCommerceGet Directions MapShared Files – Frontend File Upload Form & Secure File SharingWP Comment Cleaner – Delete All Comments, Disable Comments, Bulk Delete & Remove CommentsPinblocks — Gutenberg blocks with Pinterest widgetsGlorious Services & SupportBuddyPress WooCommerce My Account Integration. Create WooCommerce Member PagesWP Mobile Menu – The Mobile-Friendly Responsive MenuWordPress Reviews by ReviewPressAdd Linkedin insight tags for Linkedin adsConsultPress LiteWP Required Taxonomies – Categories and Tags MandatoryA no-code page builder for beautiful performance-based contentUltimate Bulk SEO Noindex Nofollow – Speed up Penalty Recovery Ultimate SEO BoosterHide Shipping Method For WooCommerceShipping Method Display Style for WooCommerceLightbox – EverlightBox GalleryLogo Showcase – Responsive Logo Carousel, Logo Slider & Logo GridSV Proven ExpertDynific Addons for Elementor (formerly AnyWhere Elementor)Wadi SurveyRemove Add to Cart WooCommerceazw woocommerce file uploadsWp My Admin BarGuestofy – Restaurant Reservations Plugin, Room Planer, Reservation FormGFireM Fields3D Viewer – Display Interactive 3D ModelsFeedbackScout: The easiest way to collect, prioritise, manage and track customer feedback.Fraud Prevention For WooCommerce and EDDCryptocurrency Portfolio TrackerКнопка ЮMoneyTag Groups is the Advanced Way to Display Your Taxonomy TermsWP Munich Blocks – Gutenberg Blocks for WordPressStreamCast – Live Radio Streaming PlayerWP AutoMedicW3SCloud Contact Form 7 to Zoho CRMWP Event Partners – WordPress Plugin for Event and Conference ManagementFood Store – Online Food Delivery & PickupXT Points & Rewards for WooCommerceRocket Maintenance Mode & Coming Soon PageSpotlight Social Feeds – Block, Shortcode, and WidgetForceFieldForms to Zapier, Integromat, IFTTT, Workato, Automate.io, elastic.io, Built.io, APIANT, WebhookPrint My Blog – Print, PDF, & eBook Converter WordPress PluginRecurWP – WordPress Recurly Payment GatewayLimb Gallery | Create Beautiful Image & Video GalleriesOut of stock display for woocommercePersistent LoginAnnouncement & Notification Banner – BulletinLearnMoreIvory Search – WordPress Search PluginImage Photo Gallery Final Tiles GridEasy Settings for LearnDashWP Radio – Worldwide Online Radio Stations Directory for WordPressBefore and After Product Images for WooCommerceScheduled Notification BarWoowGallerySTAX Header BuilderWP-Cron Status CheckerGo Viral – social share, social sharebar, social locker, social chat, open graph, reactions, share & view countersBulk Auto Image Title Attribute (Image Title tag) optimizer (Image SEO)Justified GalleryWPBakery Page Builder Addons by LivemeshEasy Zillow ReviewsTabs with Recommended Posts (Widget)WP SierraFront End PMWP Frontend Admin – Display WP Admin Pages in the FrontendEmail TrackerPerformance KitEmail Header FooterWP Post BlockSimple Giveaways – Grow your business, email lists and traffic with contestsCheckout with Zelle on WoocommerceThank You Page for WooCommerceMapGeo – Interactive Geo MapsPost to Google My Business (Google Business Profile)WP Link BioAdFoxly – Ad Manager, AdSense Ads & Ads.txtPoints Management System For Gamification, Ranks, Badges, and Loyalty Rewards Program – myCredKRSP Frontend File UploaderUltimate Blocks – 25+ Gutenberg Blocks for Block EditorStarfish Review Generation & Marketing for WordPressB2B Request a QuoteLivemesh Addons by ElementorWP Contact Slider – Contact Form Slider WidgetTK SmugMug Slideshow ShortcodeEmails Blacklist for Everest FormsCoinbase Commerce – Crypto Gateway for WooCommerceUnlimited Elements For ElementorWooCommerce Variation Swatches for ProductsWCC SEO Keyword ResearchRankBearGift Message for WooCommerceSouth Pole: Climate action nowWidgets on PagesContact Widgets For Elementor all the contact links you need in one placeSecurity Ninja – WordPress Security & FirewallProduct Country Restrictions for WooCommerce – Country CatalogsGallery PhotoBlocksWordPress Buffer – HYPESocial. Social Media Auto Post, Social Media Auto Publish and ScheduleFloating Social Share Icons and Social Share buttons – Next Previous Post Links – FLSparrow: Product Reviews and Ratings for WooCommerceLive Scores for SportsPressBroadcast LiteAffiliate Link Builder Plugin for Amazon Associates – Review EngineBulk Edit Products for WooCommerce – WP Sheet EditorDivi CollageEasy Age VerifyDisable Payment Methods based on cart conditions for WooCommerceDashy – Google Analytics advanced dashboardCheckout with Venmo on EDDWP Smart Export (Free)Better Messages – WCFM IntegrationAdvanced Custom Fields options import/exportTurbo WidgetsArendelleExtra Fees for WooCommerce
CWE ID-CWE-862
Missing Authorization