Logo
-

Byte Open Security

(ByteOS Network)

Log In

Sign Up

ByteOS

Security
Vulnerability Details
Registries
Custom Views
Weaknesses
Attack Patterns
Filters & Tools
Vulnerability Details :

CVE-2021-4366

Summary
Assigner-Wordfence
Assigner Org ID-b15e7b5b-3da4-40ae-a43c-f7aa60e62599
Published At-07 Jun, 2023 | 01:51
Updated At-20 Dec, 2024 | 23:51
Rejected At-
Credits

The PWA for WP & AMP plugin for WordPress is vulnerable to authorization bypass due to a missing capability check on the pwaforwp_update_features_options function in versions up to, and including, 1.7.32. This makes it possible for authenticated attackers to change the otherwise restricted settings within the plugin.

Vendors
-
Not available
Products
-
Metrics (CVSS)
VersionBase scoreBase severityVector
Weaknesses
Attack Patterns
Solution/Workaround
References
HyperlinkResource Type
EPSS History
Score
Latest Score
-
N/A
No data available for selected date range
Percentile
Latest Percentile
-
N/A
No data available for selected date range
Stakeholder-Specific Vulnerability Categorization (SSVC)
▼Common Vulnerabilities and Exposures (CVE)
cve.org
Assigner:Wordfence
Assigner Org ID:b15e7b5b-3da4-40ae-a43c-f7aa60e62599
Published At:07 Jun, 2023 | 01:51
Updated At:20 Dec, 2024 | 23:51
Rejected At:
▼CVE Numbering Authority (CNA)

The PWA for WP & AMP plugin for WordPress is vulnerable to authorization bypass due to a missing capability check on the pwaforwp_update_features_options function in versions up to, and including, 1.7.32. This makes it possible for authenticated attackers to change the otherwise restricted settings within the plugin.

Affected Products
Vendor
Mohammed & Ahmed Kaludi (Magazine3)magazine3
Product
PWA for WP & AMP
Default Status
unaffected
Versions
Affected
  • From * through 1.7.32 (semver)
Problem Types
TypeCWE IDDescription
N/AN/ACWE-862 Missing Authorization
Type: N/A
CWE ID: N/A
Description: CWE-862 Missing Authorization
Metrics
VersionBase scoreBase severityVector
3.16.3MEDIUM
CVSS:3.1/AV:N/AC:L/PR:L/UI:N/S:U/C:L/I:L/A:L
Version: 3.1
Base score: 6.3
Base severity: MEDIUM
Vector:
CVSS:3.1/AV:N/AC:L/PR:L/UI:N/S:U/C:L/I:L/A:L
Metrics Other Info
Impacts
CAPEC IDDescription
Solutions

Configurations

Workarounds

Exploits

Credits

finder
Jerome Bruandet
Timeline
EventDate
Disclosed2021-07-01 00:00:00
Event: Disclosed
Date: 2021-07-01 00:00:00
Replaced By

Rejected Reason

References
HyperlinkResource
https://www.wordfence.com/threat-intel/vulnerabilities/id/a9892dd1-3939-41a9-a828-fa1bf7d96eb8?source=cve
N/A
https://blog.nintechnet.com/wordpress-pwa-for-wp-and-amp-plugin-fixed-vulnerabilities/
N/A
https://wpscan.com/vulnerability/b38a51d7-375e-4cca-88ba-ccab796ac134
N/A
Hyperlink: https://www.wordfence.com/threat-intel/vulnerabilities/id/a9892dd1-3939-41a9-a828-fa1bf7d96eb8?source=cve
Resource: N/A
Hyperlink: https://blog.nintechnet.com/wordpress-pwa-for-wp-and-amp-plugin-fixed-vulnerabilities/
Resource: N/A
Hyperlink: https://wpscan.com/vulnerability/b38a51d7-375e-4cca-88ba-ccab796ac134
Resource: N/A
▼Authorized Data Publishers (ADP)
1. CVE Program Container
Affected Products
Metrics
VersionBase scoreBase severityVector
Metrics Other Info
Impacts
CAPEC IDDescription
Solutions

Configurations

Workarounds

Exploits

Credits

Timeline
EventDate
Replaced By

Rejected Reason

References
HyperlinkResource
https://www.wordfence.com/threat-intel/vulnerabilities/id/a9892dd1-3939-41a9-a828-fa1bf7d96eb8?source=cve
x_transferred
https://blog.nintechnet.com/wordpress-pwa-for-wp-and-amp-plugin-fixed-vulnerabilities/
x_transferred
https://wpscan.com/vulnerability/b38a51d7-375e-4cca-88ba-ccab796ac134
x_transferred
Hyperlink: https://www.wordfence.com/threat-intel/vulnerabilities/id/a9892dd1-3939-41a9-a828-fa1bf7d96eb8?source=cve
Resource:
x_transferred
Hyperlink: https://blog.nintechnet.com/wordpress-pwa-for-wp-and-amp-plugin-fixed-vulnerabilities/
Resource:
x_transferred
Hyperlink: https://wpscan.com/vulnerability/b38a51d7-375e-4cca-88ba-ccab796ac134
Resource:
x_transferred
2. CISA ADP Vulnrichment
Affected Products
Metrics
VersionBase scoreBase severityVector
Metrics Other Info
Impacts
CAPEC IDDescription
Solutions

Configurations

Workarounds

Exploits

Credits

Timeline
EventDate
Replaced By

Rejected Reason

References
HyperlinkResource
Information is not available yet
▼National Vulnerability Database (NVD)
nvd.nist.gov
Source:security@wordfence.com
Published At:07 Jun, 2023 | 02:15
Updated At:07 Nov, 2023 | 03:40

The PWA for WP & AMP plugin for WordPress is vulnerable to authorization bypass due to a missing capability check on the pwaforwp_update_features_options function in versions up to, and including, 1.7.32. This makes it possible for authenticated attackers to change the otherwise restricted settings within the plugin.

CISA Catalog
Date AddedDue DateVulnerability NameRequired Action
N/A
Date Added: N/A
Due Date: N/A
Vulnerability Name: N/A
Required Action: N/A
Metrics
TypeVersionBase scoreBase severityVector
Primary3.14.3MEDIUM
CVSS:3.1/AV:N/AC:L/PR:L/UI:N/S:U/C:N/I:L/A:N
Secondary3.16.3MEDIUM
CVSS:3.1/AV:N/AC:L/PR:L/UI:N/S:U/C:L/I:L/A:L
Type: Primary
Version: 3.1
Base score: 4.3
Base severity: MEDIUM
Vector:
CVSS:3.1/AV:N/AC:L/PR:L/UI:N/S:U/C:N/I:L/A:N
Type: Secondary
Version: 3.1
Base score: 6.3
Base severity: MEDIUM
Vector:
CVSS:3.1/AV:N/AC:L/PR:L/UI:N/S:U/C:L/I:L/A:L
CPE Matches

Mohammed & Ahmed Kaludi (Magazine3)
magazine3
>>pwa_for_wp_\&_amp>>Versions before 1.7.33(exclusive)
cpe:2.3:a:magazine3:pwa_for_wp_\&_amp:*:*:*:*:*:wordpress:*:*
Weaknesses
CWE IDTypeSource
CWE-862Primarynvd@nist.gov
CWE ID: CWE-862
Type: Primary
Source: nvd@nist.gov
Evaluator Description

Evaluator Impact

Evaluator Solution

Vendor Statements

References
HyperlinkSourceResource
https://blog.nintechnet.com/wordpress-pwa-for-wp-and-amp-plugin-fixed-vulnerabilities/security@wordfence.com
Exploit
Third Party Advisory
https://wpscan.com/vulnerability/b38a51d7-375e-4cca-88ba-ccab796ac134security@wordfence.com
Third Party Advisory
https://www.wordfence.com/threat-intel/vulnerabilities/id/a9892dd1-3939-41a9-a828-fa1bf7d96eb8?source=cvesecurity@wordfence.com
Third Party Advisory
Hyperlink: https://blog.nintechnet.com/wordpress-pwa-for-wp-and-amp-plugin-fixed-vulnerabilities/
Source: security@wordfence.com
Resource:
Exploit
Third Party Advisory
Hyperlink: https://wpscan.com/vulnerability/b38a51d7-375e-4cca-88ba-ccab796ac134
Source: security@wordfence.com
Resource:
Third Party Advisory
Hyperlink: https://www.wordfence.com/threat-intel/vulnerabilities/id/a9892dd1-3939-41a9-a828-fa1bf7d96eb8?source=cve
Source: security@wordfence.com
Resource:
Third Party Advisory

Change History

0
Information is not available yet

Similar CVEs

867Records found

CVE-2024-32143
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-4.3||MEDIUM
EPSS-0.55% / 66.85%
||
7 Day CHG~0.00%
Published-11 Jun, 2024 | 17:03
Updated-19 Mar, 2025 | 18:52
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Podlove Podcast Publisher plugin <= 4.1.0 - Broken Access Control vulnerability

Missing Authorization vulnerability in Podlove Podlove Podcast Publisher.This issue affects Podlove Podcast Publisher: from n/a through 4.1.0.

Action-Not Available
Vendor-podlovePodlovepodlove
Product-podlove_podcast_publisherPodlove Podcast Publisherpodlove_podcast_publisher
CWE ID-CWE-862
Missing Authorization
CVE-2024-31307
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-6.3||MEDIUM
EPSS-0.08% / 23.51%
||
7 Day CHG~0.00%
Published-09 Jun, 2024 | 18:08
Updated-02 Aug, 2024 | 01:52
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Easy Social Share Buttons plugin <= 9.4 - Multiple Broken Access Control vulnerability

Missing Authorization vulnerability in appscreo Easy Social Share Buttons.This issue affects Easy Social Share Buttons: from n/a through 9.4.

Action-Not Available
Vendor-appscreoidiom_interactive
Product-Easy Social Share Buttonseasy_social_share_buttons
CWE ID-CWE-862
Missing Authorization
CVE-2024-32148
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-4.3||MEDIUM
EPSS-0.11% / 29.52%
||
7 Day CHG~0.00%
Published-11 Jun, 2024 | 14:44
Updated-02 Aug, 2024 | 02:06
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Pardot plugin <= 2.1.0 - Broken Access Control vulnerability

Missing Authorization vulnerability in Salesforce Pardot.This issue affects Pardot: from n/a through 2.1.0.

Action-Not Available
Vendor-Salesforce
Product-Pardot
CWE ID-CWE-862
Missing Authorization
CVE-2024-31359
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-4.3||MEDIUM
EPSS-0.22% / 44.55%
||
7 Day CHG~0.00%
Published-09 Jun, 2024 | 17:20
Updated-26 Sep, 2024 | 13:58
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Premmerce Product Filter for WooCommerce plugin <= 3.7.2 - Broken Access Control vulnerability

Missing Authorization vulnerability in Premmerce Premmerce Product Filter for WooCommerce.This issue affects Premmerce Product Filter for WooCommerce: from n/a through 3.7.2.

Action-Not Available
Vendor-premmercePremmerce
Product-premmerce_product_filter_for_woocommercePremmerce Product Filter for WooCommerce
CWE ID-CWE-862
Missing Authorization
CVE-2023-1414
Matching Score-4
Assigner-WPScan
ShareView Details
Matching Score-4
Assigner-WPScan
CVSS Score-4.3||MEDIUM
EPSS-0.05% / 13.43%
||
7 Day CHG~0.00%
Published-24 Apr, 2023 | 18:31
Updated-04 Feb, 2025 | 16:15
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WP VR < 8.3.0 - Subscriber+ Arbitrary Tour Update

The WP VR WordPress plugin before 8.3.0 does not have authorisation and CSRF checks in various AJAX actions, one in particular could allow any authenticated users, such as subscriber to update arbitrary tours

Action-Not Available
Vendor-rexthemeUnknown
Product-wp_vrWP VR
CWE ID-CWE-352
Cross-Site Request Forgery (CSRF)
CWE ID-CWE-862
Missing Authorization
CVE-2024-31294
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-4.3||MEDIUM
EPSS-0.22% / 44.55%
||
7 Day CHG~0.00%
Published-09 Jun, 2024 | 08:50
Updated-05 Oct, 2024 | 02:01
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress WP Sort Order plugin <= 1.3.1 - Broken Access Control vulnerability

Missing Authorization vulnerability in Fahad Mahmood WP Sort Order.This issue affects WP Sort Order: from n/a through 1.3.1.

Action-Not Available
Vendor-androidbubbleFahad Mahmood
Product-wp_sort_orderWP Sort Order
CWE ID-CWE-862
Missing Authorization
CVE-2024-31421
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-4.3||MEDIUM
EPSS-0.21% / 43.09%
||
7 Day CHG~0.00%
Published-15 Apr, 2024 | 10:09
Updated-02 Aug, 2024 | 01:52
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Popup by Supsystic plugin <= 1.10.27 - Broken Access Control vulnerability

Missing Authorization vulnerability in Supsystic Popup by Supsystic.This issue affects Popup by Supsystic: from n/a through 1.10.27.

Action-Not Available
Vendor-Supsystic
Product-Popup by Supsystic
CWE ID-CWE-862
Missing Authorization
CVE-2024-31347
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-4.3||MEDIUM
EPSS-0.11% / 30.45%
||
7 Day CHG~0.00%
Published-09 Jun, 2024 | 18:06
Updated-02 Aug, 2024 | 01:52
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Tracking Code Manager plugin <= 2.1.0 - Broken Access Control vulnerability

Missing Authorization vulnerability in Data443 Tracking Code Manager.This issue affects Tracking Code Manager: from n/a through 2.1.0.

Action-Not Available
Vendor-Data443
Product-Tracking Code Manager
CWE ID-CWE-862
Missing Authorization
CVE-2024-32144
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-5.4||MEDIUM
EPSS-0.07% / 20.52%
||
7 Day CHG~0.00%
Published-11 Jun, 2024 | 15:48
Updated-09 Aug, 2024 | 18:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Welcart e-Commerce plugin <= 2.9.14 - Broken Access Control vulnerability

Missing Authorization vulnerability in Welcart Inc. Welcart e-Commerce.This issue affects Welcart e-Commerce: from n/a through 2.9.14.

Action-Not Available
Vendor-welcartWelcart Inc.
Product-welcart_e-commerceWelcart e-Commerce
CWE ID-CWE-862
Missing Authorization
CVE-2024-32081
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-4.3||MEDIUM
EPSS-0.22% / 44.55%
||
7 Day CHG~0.00%
Published-09 Jun, 2024 | 18:37
Updated-02 Aug, 2024 | 02:06
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Filter Custom Fields & Taxonomies Light plugin <= 1.05 - Broken Access Control vulnerability

Missing Authorization vulnerability in Websupporter Filter Custom Fields & Taxonomies Light.This issue affects Filter Custom Fields & Taxonomies Light: from n/a through 1.05.

Action-Not Available
Vendor-websupporter_filter_custom_fields_\&_taxonomies_light_projectWebsupporter
Product-websupporter_filter_custom_fields_\&_taxonomies_lightFilter Custom Fields & Taxonomies Light
CWE ID-CWE-862
Missing Authorization
CVE-2024-31350
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-4.3||MEDIUM
EPSS-0.24% / 47.16%
||
7 Day CHG~0.00%
Published-09 Jun, 2024 | 18:04
Updated-25 Sep, 2024 | 14:36
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress AWP Classifieds plugin <= 4.3.1 - Broken Access Control vulnerability

Missing Authorization vulnerability in AWP Classifieds Team AWP Classifieds.This issue affects AWP Classifieds: from n/a through 4.3.1.

Action-Not Available
Vendor-Strategy11
Product-awp_classifiedsAWP Classifieds
CWE ID-CWE-862
Missing Authorization
CVE-2023-1027
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.3||MEDIUM
EPSS-0.07% / 21.67%
||
7 Day CHG~0.00%
Published-28 Feb, 2023 | 12:54
Updated-13 Jan, 2025 | 17:03
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

The WP Meta SEO plugin for WordPress is vulnerable to unauthorized sitemap generation due to a missing capability check on the checkAllCategoryInSitemap function in versions up to, and including, 4.5.3. This makes it possible for authenticated attackers with subscriber-level access to obtain post categories. This vulnerability occurred as a result of the plugin relying on nonce checks as a means of access control, and that nonce being accessible to all authenticated users regardless of role.

Action-Not Available
Vendor-JoomUnited
Product-wp_meta_seoWP Meta SEO
CWE ID-CWE-862
Missing Authorization
CVE-2024-31281
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-6.3||MEDIUM
EPSS-0.34% / 55.70%
||
7 Day CHG~0.00%
Published-17 May, 2024 | 08:54
Updated-02 Aug, 2024 | 01:46
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Church Admin plugin <= 4.1.6 - Broken Access Control vulnerability

Missing Authorization vulnerability in Andy Moyle Church Admin church-admin allows Exploiting Incorrectly Configured Access Control Security Levels.This issue affects Church Admin: from n/a through 4.1.6.

Action-Not Available
Vendor-Andy Moyle
Product-Church Admin
CWE ID-CWE-862
Missing Authorization
CVE-2023-0405
Matching Score-4
Assigner-WPScan
ShareView Details
Matching Score-4
Assigner-WPScan
CVSS Score-5.4||MEDIUM
EPSS-0.13% / 33.23%
||
7 Day CHG~0.00%
Published-13 Feb, 2023 | 14:32
Updated-21 Mar, 2025 | 20:15
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
GPT3 AI Content Writer < 1.4.38 - Subscriber+ Arbitrary Post Content Update

The GPT AI Power: Content Writer & ChatGPT & Image Generator & WooCommerce Product Writer & AI Training WordPress plugin before 1.4.38 does not perform any kind of nonce or privilege checks before letting logged-in users modify arbitrary posts.

Action-Not Available
Vendor-gptaipowerUnknown
Product-gpt_ai_powerGPT AI Power: Content Writer & ChatGPT & Image Generator & WooCommerce Product Writer & AI Training
CWE ID-CWE-862
Missing Authorization
CVE-2025-49976
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-4.3||MEDIUM
EPSS-0.04% / 10.65%
||
7 Day CHG~0.00%
Published-20 Jun, 2025 | 15:04
Updated-23 Jun, 2025 | 20:52
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress WANotifier plugin <= 2.7.7 - Broken Access Control Vulnerability

Missing Authorization vulnerability in WANotifier WANotifier allows Exploiting Incorrectly Configured Access Control Security Levels. This issue affects WANotifier: from n/a through 2.7.7.

Action-Not Available
Vendor-WANotifier
Product-WANotifier
CWE ID-CWE-862
Missing Authorization
CVE-2022-4974
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-6.3||MEDIUM
EPSS-0.07% / 22.12%
||
7 Day CHG~0.00%
Published-16 Oct, 2024 | 06:43
Updated-16 Oct, 2024 | 18:06
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Freemius SDK <= 2.4.2 - Missing Authorization Checks

The Freemius SDK, as used by hundreds of WordPress plugin and theme developers, was vulnerable to Cross-Site Request Forgery and Information disclosure due to missing capability checks and nonce protection on the _get_debug_log, _get_db_option, and the _set_db_option functions in versions up to, and including 2.4.2. Any WordPress plugin or theme running a version of Freemius less than 2.4.3 is vulnerable.

Action-Not Available
Vendor-wpscriptskokomowebstylingwebbenrenaudbodedgegallerypluginwpcohortpippozanardopagebuildersandwichsmusman98muhammad-rehmansslzentauhidprofastaf/jetixwpdanielealessandrapagupthemeseidvizheniawpconedevbavokoservicesjanthielemannskshaikatwpt00lsmarviorochabouncingsproutmberdingcliffpaulickbfintalcodeiesmilukovemdedevsamuelsilvaptstarfishwptonyzeoliw3scloudpootlepress/fullworkswpbitslinekalcodexonicsdanish-alilostboy7benmoreassyntwpvibesdaniyalahmedkolezhyk5webmuehledarellxjohnyklukeseagerthemestystreamweaselswphrmanagerzerozendesignivanchernyakov9brada6tobias_conrad/bestpluginswordpressbadhonrockspootlepressmatthias-reutertribalnerdalanfullerthemeythemeswp-makingtycoon12344iksstudiorankbearspartacscrollsequencemajicklkoudalankitmaruwptbtobias_conradjosevegadangub86moomooagencytheafricanboss/attestimtiazrayhanmaciejbak85cebbipaulio21ahmed17galoovercommercepunditwebheadllceedeeivan_paulinkitforesttickerakhothemeschetmacmodulemasterstprintyedisonaveclosemarketing/gowebsmartymarcqueraltchillichalliwhiteshadowsalttechnowptravelenginepmbaldha/sslatlasdrosendobradvinalphabposerviceatakanozlitonice13unitecmskairashabticleverpluginssjavedrichard-bgloriousthemespowerfulwpstevehentyjkohlbachmohammedrezqpeterschulznlprinceahmedkitthemesmunirkamalandyabelowsamdanidiviframeworkcreativethemeshqversacompgfiremdudokrspsj_oaharonyanmvvapps/davidandersonoceanwppassionatebrainscodesavoryxplodedthemeslivemeshsindyakinsergeimattpramschuferswitcorpwpdeliciousdgwyergiladtakoniclickervoltwpschoolcalendarprotectyouruploadsjburleigh1rafalosinskijohnc1979anfrageformularclosemarketingcypressnorthequalizedigitalalleythemeswoodyhaydayoceasrebelcodepopeatingaguilerasoftelliotvsdam6plekanathmilmorsonalsinha21dipcodeshelob9svenl77jurskicloudspongemaltathemesjwebsolpluginandplaywpcohort/pluginswarewgaugenpluginswppluginexpertsupfivdamian-goramelapresscodeatlanticwpeventpartners/wpexpertsioirkanuavidthemes/theafricanbossslidedeckweconnectcodeappexpertsioblocksparewiserstepssakurapixelinterfacelabmeowcrewmajick/ethereumicoioskymindsjavmahnicheaddonsalex-yerisethemeblockypagedjenhwpsoulfoxmoonmnelson4ggriesserwoopopsgallerycreatormumarym1985collizo4skysovstackthinleekpremmercewalkerwpsyntacticsgkher/wpgeniuzwpmagicssvovafwebtechstreetpatrickposnerggeddetranzlywpmunichtripettotakanakuiessekiaglowlogixmikebelsintoxstudiomojofywpwpdevpowersnasirahmedoloyede-jamiuthecodechimedreamfoxkylegilmanmantrabraininfosatechmhmrajibhiddenpearlsultimateblocksplugins360thijzienitin247infornwebtoddhalfpennymbrown24cloudlivingkkikuchi1220zeethemelimbcodeultradevsproteusthemesfsruslanpmbaldhaalexmossldninjas/vincoitactuaryzaskbilaltasdovypcmbibby/surbmakaizencodersdejanmarkovicmulticollabmohsinofflinesebetwpeka-clubalekvstevejburgepatrickgarmanjanwylcyberhoboarabianmidoivacykaggdesignroyalnavneetmcurlyusmanaliqureshijaydeep-nimavatbpluginsvinod-dalviseezeepenguininitiativesbeeneebmeepluginswupoxyulexbrandonfiredotsshawoninfoboriscolombier/paretodigitalvanyukovblockmeisterkartikparmar/ejslondon/maurolopes/kartechifyuriahs-victorronena100tropicalistagetsparrowcarlosmoreiraptvernaljcodexbycrikmte90halmatdeothemeswordpresschefdivisumofrostbourninvisnetprasadkirpekarninjalibsseancarricoannastaajwindshamim51staxwpmikewire_rocksolidmaxsdesignkartikparmarmihail-barinovibenicsebet/boltonstudiosmatstarstherealwebdisruptsmartwpressthemelocationkenanfallongreenjaymediacromer12bandidoelementinvaderwpchill5starpluginsmilukove/cadudecastroalvesh3technologieslynn999webba-agencymasterblockswordplussangaranco2okpasyukfrenifydotrexprelcsetkahqthemejamesparkninjaflexithemesdaigo75anssilaitilawpmoosebuttonizeranasbinmukimlistplussmgteamakdevsblackandwhitedigitalsnazzythemeswpengineelbisneroinputwphumblethemeswpdeverrafacarvalhidojack-kitterhingwpjolivohotv/Royal Elementor AddonsBdThemesThe Events Calendar (StellarWP)Themeisle
Product-Panorama Viewer- Best Plugin to Display Panoramic Images/VideosWooCommerce Variation Swatches for ProductsEasy Post Views CountWoocommerce Customer Reviews with Artificial Intelligence analyzis, with IBM Watson Tone AnalyzerOcean ExtraCodeKit – Custom Codes EditorForm Vibes – Database Manager for FormsGFireM Advance SearchSTEWoo – Super Transactional Emails for WooCommerceBlockMeister – Block Pattern BuilderWordPress Directory Plugin For Business Listings – WP Local PlusAirpressWP Sessions Time Monitoring Full AutomaticEmails Blacklist for Everest FormsSmart Floating / Sticky Buttons – Call, Sharing, Chat Widgets & More – ButtonizerExpire tagsXT Ajax Add To Cart for WooCommerceBefore and After Product Images for WooCommerceVillarWP Search FilterFunnelmentalsFrontend group restriction for LearnDashSEO BoosterTeam Members – A WordPress Team Plugin with Gallery, Grid, Carousel, Slider, Table, List, and MorePro Broken Links MaintainerPremmerce Product Filter for WooCommerceDancePress (TRWA)Walker CoreBAVOKO SEO Tools – All-in-One WordPress SEOWP Security Safejav&#039;s – WooCommerce and Trello integration WooTrelloWP School CalendarBooking Addon for WooCommerceStation ProProduct Carousel For WooCommerce – WoorouSellCartPops – High Converting Add To Cart Popup For WooCommerceGiveaways for woocommerceBuddyPress WooCommerce My Account Integration. Create WooCommerce Member PagesGreenshift – animation and page builder blocksAtlas – Knowledge BaseWP GratifyBetter Messages – Integration for WC Vendors MarketplaceBlocksy CompanionQyrr – simply and modern QR-Code creationannasta Woocommerce Product FiltersWP Tools Gravity Forms Divi ModuleTablesome – Form DB & Automation – WPForms, Contact Form 7, Elementor, Forminator, Fluent, GravityClimateClick: Climate Action for allA no-code page builder for beautiful performance-based contentArendelleMarket ExporterConnected SermonsLightbox & Modal Popup WordPress Plugin – FooBoxStarfish Review Generation & Marketing for WordPressWooCommerce Disable Payment Methods based on cart conditionsSticky add to cart for WooPost Slider and Post Carousel with Post Vertical Scrolling Widget – A Responsive Post SliderSecurity Ninja – Secure Firewall & Secure Malware ScannerPopOverXYZ – Show Light Weight Beautiful Tool Tips On Any TextEasy Age VerifyNotification Bar, Announcement and Cookie Notice WordPress Plugin – FooBarPremmerce Variation Swatches for WooCommerceProduct Size Charts Plugin for WooCommercePost Carousel DiviAge Verification Screen for WooCommerceSuper Video Player- Best WordPress Video Display Plugin for mp4/OGGSimple Giveaways – Grow your business, email lists and traffic with contestsHQTheme ExtraGlossaryAutomizy Gravity FormsExtend Filter Products By Price WidgetOrder and Inventory Manager for WooCommerceAdvanced Database ReplacerStore Toolkit – WooCommerce Extensions, Quick Enhancements & Handy ToolsLivemesh Addons for Beaver BuilderAbeta Link PunchOutMaster Blocks – Gutenberg Site BuilderPremmerce Permalink Manager for WooCommerceShipping Method Display Style for WooCommerceSpanish Market Enhancements for WooCommerceFeedbackScout: The easiest way to collect, prioritise, manage and track customer feedback.Restaurant & Cafe Addon for ElementorPost Form – Registration Form – Profile Form for User Profiles – Frontend Content Forms for User Submissions (UGC)WordPress Slider Block GutensliderWP Lead StreamAquarella LiteReally Simple Featured Video – Featured video support for Posts, Pages & WooCommerce ProductsVidSEO | WordPress Video SEO embedder with transcripts (Youtube & Vimeo)WPMailer – The best mail builder, No More Core for your emails support Elementor, CF7 forms etc…Multi Page Auto Advance for Gravity FormsTreePress – Easy Family Trees & Ancestor ProfilesCookie Consent for WP – Cookie Consent, Consent Log, Cookie Scanner, Script Blocker (for GDPR, CCPA & ePrivacy)3D Viewer – 3D Model Viewer PluginPurusDisplay Eventbrite EventsMedia Cloud for Bunny CDN, Amazon S3, Cloudflare R2, Google Cloud Storage, DigitalOcean and moreAPPExperts – Mobile App Builder for WordPress | WooCommerce to iOS and Android AppsWP Event Partners – WordPress Plugin for Event and Conference ManagementFloating Social Share Icons and Social Share buttons – Next Previous Post Links – FLPortfolio for Elementor & Image Gallery | PowerFolioWidgets for WooCommerce Products on ElementorStoreCustomizer – A plugin to Customize all WooCommerce PagesEmail Tracker – Email Tracking Plugin to track Emails for Open and Email Links Click (Compatible with WooCommerce)Prime Slider – Addons For Elementor (Revolution of a slider, Hero Slider, Ecommerce Slider)Custom WooCommerce Checkout Fields EditorEqualize Digital Accessibility Checker – Audit Your Website for WCAG, ADA, and Section 508 Accessibility ErrorsSalon Booking SystemWooCommerce EU VAT AssistantThe Events CalendarBulk Attachment DownloadListPlus – Unlimited Listing DirectoryMenu Item SchedulerWP Photo EffectsWordPress Reviews by ReviewPressAuto SEO META keywords (META tags keywords) optimization + WooCommerceJoli Table Of ContentsOne Click LoginEmail Header FooterBulk Auto Image Title Attribute (Image Title tag) optimizer (Image SEO)Woocommerce Customers Order HistoryImage Photo Gallery Final Tiles GridNitek Carousel Slider Cool TransitionsEasy Zillow ReviewsStreamCast – Radio Player for WordPressXT Variation Swatches for WooCommerceMenu Image, Icons made easyCryptocurrency Portfolio TrackerWS BootstrapWP Mobile Menu – The Mobile-Friendly Responsive MenuFast Checkout for WooCommerceSmart Variations Images & Swatches for WooCommerceMailChimp ManagerWp My Admin BarDeals of the Day WooCommerceHasiumResponsive Social Slider WidgetPage Builder Gutenberg Blocks – Kioken BlocksPage Builder Sandwich – Front End WordPress Page Builder PluginLivemesh SiteOrigin WidgetsViralikeCustom Registration and Custom Login Forms with New RecaptchaBattle Suit for DiviJDs PortfolioSV Proven ExpertVO Store Locator – WP Store Locator PluginReset Course Progress For LearnDashFront End PMRecurWP – WordPress Recurly Payment GatewayGlorious Services & SupportShubanIvory Search – WordPress Search PluginServer InfoBlog Sidebar WidgetAgy – Age verification for WooCommerceGoogle Analytics plugin for WordPress by GA4WPWP EasyPay – Square for WordPressWP Munich Blocks – Gutenberg Blocks for WordPressPremmerce Wishlist for WooCommerceNokkeBroadcast LiteWP Conference ScheduleEasy Newsletter SignupsAlley Business ToolkitReplyable – Subscribe to Comments and Reply by EmailNumber ChatCountry Based Payments for WooCommerceWebinar Solution: Create live/evergreen/automated/instant webinars, stream & Zoom Meetings | WebinarIgnitionSchema Plugin For Divi, Gutenberg & ShortcodesPower Ups for ElementorWordPress Everse Starter Sites – Elementor TemplatesContact Form 7 Multi-Step FormsAccept Stripe Donation and Payments – AidWPInternal Link Juicer: SEO Auto Linker for WordPressWoo UkrposhtaPage Builder for Gutenberg – StarterBlocksGet feedback from visitors – WP Feedback Suite PluginNEXUSBanner Management For WooCommerceScheduled Notification BarUltimate Blocks – WordPress Blocks PluginGenealogical Tree – WordPress Family TreeLearnMoreMaster Addons – Elementor Addons with White Label, Free Widgets, Hover Effects, Conditions, & AnimationsProduct Author for WooCommerceLightbox – EverlightBox GalleryImpexium Single Sign OnLive TV Player – Worldwide Live TV Channels Player for WordPressPrice Bands for WooCommerceVit Website ReviewsRevolution for ElementorGloriousThemes Starter SitesWordPress Robots.txt optimizer (+ XML Sitemap) – Boost SEO, Traffic & RankingsGallery Blocks with Lightbox. Image Gallery, (HTML5 video , YouTube, Vimeo) Video Gallery and Lightbox for native galleryGo Fetch Jobs (for WP Job Manager)Geo MashupFive-Star Ratings ShortcodeActivity Log For MainWPContent Aware Sidebars – Fastest Widget Area PluginBaniInsert or Embed Articulate Content into WordPressRadio Station by netmix® – Manage and play your Show Schedule in WordPress!Anfrageformular – Multi Step Drag & Drop Formular Builder – LeadgenerierungTabs with Recommended Posts (Widget)Performance KitWP BugBotTag Groups is the Advanced Way to Display Your Taxonomy TermsRW Divi Unite GalleryWP Get PersonalAdvance Menu ManagerBulk WooCommerce Category CreatorWP Delicious – Recipe Plugin for Food Bloggers (formerly Delicious Recipes)LawPress – Law Firm Website ManagementTinyMCE AnnotateElationElements for LifterLMSGFireM FieldsHooked Editable ContentConsultPress LiteFooGallery – Responsive Photo Gallery, Image Viewer, Justified, Masonry & CarouselCategorify – WordPress Media Library Category & File ManagerRestrict User Access – Ultimate Membership & Content ProtectionJustified GalleryLocal Delivery Drivers for WooCommerceStreamWeasels Twitch IntegrationFocus on Reviews for WooCommerceWP Frontend Admin – Display WP Admin Pages in the FrontendSimple Sitemap – Create a Responsive HTML SitemapOpenseaAdd Pinterest conversion tags for Pinterest Ads + Site verificationWordPress Coupon Plugin for Bloggers and Marketers – WP OffersCryptocurrency Product for WooCommerceFast WordPressExtra Fees Plugin for WooCommercePrint My Blog – Print, PDF, & eBook Converter WordPress PluginStreak CRM For Gmail For Contact Form 7 – WordPress PluginSpotlight Social Feeds – Block, Shortcode, and WidgetWP-HR Manager: The Human Resources Plugin for WordPressCAPTCHA 4WP – Antispam CAPTCHA solution for WordPressDeMomentSomTres Grid ArchiveTarot Card OracleIntegrate Google Drive – Browse, Upload, Download, Embed, Play, Share, Gallery, and Manage Your Google Drive Files into Your WordPress SiteWooCommerce Customers Table: View, Search, Bulk EditorChat Button- Leads and Order over ChatAll in One Invite CodesWP Meta and Date RemoverRating-Widget: Star Review SystemSurbma | GDPR Proof Cookie Consent & Notice BarEasy Code SnippetsComments Not Replied ToImage Carousel For DiviCuisine PalaceWP Radio – Worldwide Online Radio Stations Directory for WordPressElastaDivi CollageSparrow: Product Reviews and Ratings for WooCommerceSV Tracking ManagerUltra Elementor AddonsWooCommerce Next Order CouponWP Contact SliderLive Scores for SportsPressPast Events ExtensionTiered Pricing Table for WooCommerceAnyWhere ElementorWP Coupons and Deals – WordPress Coupon PluginSky Login RedirectWPTools Masonry Gallery & Posts For DiviNugget by Ingot: Easy, automated and native A/B testing for everyoneWP Post BlockEverseProduct Options and Price Calculation Formulas for WooCommerce – Uni CPOFeatured Images in RSS for Mailchimp & MoreFiboSearch – Ajax Search for WooCommercePost Snippets – Custom WordPress Code Snippets CustomizerWP Smart Export (Free)Coinbase Commerce – Crypto Gateway for WooCommerceWP Dev Powers – Display Screen Dimensions to Admin PluginSSL Atlas – Free SSL Certificate & HTTPS Redirect for WordPressWP fail2ban – Advanced Security PluginXT Floating Cart for WooCommerceAuthorize.Net Payment Gateway For WooCommerceDivi Forms Styler – Gravity Forms, Fluent Forms & Contact Form 7Multipurpose Gutenberg BlockFood Store – Online Food Delivery & PickupEthereumICOACF for WooCommerce ProductPremmerce Redirect ManagerDesign for Contact Form 7 Style WordPress Plugin – CF7 WOW StylerKVoucherSheetPress – Manage WordPress Meta data with Google SheetsLive Drag and Drop Builder for Contact Form 7Ultimate Widgets LightPodcast Box – Best Podcasting Plugin for WordPressBlocked in China | Check if your site is available in the Chinese mainlandWP Author BioWooCommerce upcoming ProductsPremmerce Brands for WooCommerceVideo Player for YouTubeDelete All Comments of wordpressDigital Goods for WooCommerce CheckoutBulk Edit Posts and Products in SpreadsheetMarijuana Age VerifyWordPress News Plugin – TopNewsWpPremmerce WooCommerce Customers ManagerCP Simple NewsletterWP Frontend ProfileEasy Smooth Scroll Links – Smooth Scrolling AnchorPremmerce SEO for WooCommerceLittleBot InvoicesFrontend Admin by DynamiAppsInbound BrewCheckout with Venmo on EDDUltimate Post Kit Addons For Elementor – (Post Grid, Post Carousel, Post Slider, Category List, Post Tabs, Timeline, Post Ticker, Tag Cloud)WC Shop Sync – Square Payment Gateway for WooCommerce, Inventory Sync Between Square and WooCommerce, Ultimate WooCommerce Square PluginBulk Auto Image Alt Text (Alt tag, Alt attribute) optimizer (image SEO)Restrict – membership, site, content and user access restrictions for WordPressTK SmugMug Slideshow ShortcodeWP-Cron Status CheckerStrumenti Partita IVA per WoocommerceElementor Addons by LivemeshPrimary Addon for ElementorbbResolutionsNinja Libs Amazon SESWP SPID ItaliaMusic Player for Elementor – Audio Player & Podcast PlayerKnowledge Base documentation & wiki plugin – BasePress DocsModern Addons for Elementor Page BuilderBetter Messages – Live Chat for WordPress, BuddyPress, PeepSo, Ultimate Member, BuddyBossWP Group PromoterWidgets on PagesSpreadsheet Integration – Automate Google Sheets With WordPress, WooCommerce & Most Popular Form Plugins. Also, Display Google sheet as a Table.SVG Flags – Beautiful Scalable Flags For All Countries!Anti-Spam by Fullworks : GDPR Compliant Spam ProtectionBulk Edit Categories and Tags – Create Thousands Quickly on the EditorDelete old Posts automaticallyPremmerceTop Bar – PopUps – by WPOptinLMS Plugin – eLearning, Online Courses by AttestPost to Google My Business (Google Business Profile)EthPress – Web3 LoginUnakitLicense Manager for WooCommerceSync eCommerce NEOTK Google Fonts GDPR CompliantWP Affiliate DisclosureBlockspare: Gutenberg Blocks & Patterns for Blogs, Magazines, Business Sites – Post Grids, Sliders, Carousels, Counters, Page Builder & Starter Site Imports, No Coding NeededSpeculorDomain Mapping System | Create Microsites with Multiple Alias Domains (multisite optional)Ultimate Gutenberg – Custom Block TemplatesWidgets on Pages and PostsPayment gateway per Product for WooCommerceWP Notification BellConeBlog – Elementor Blog WidgetsWP Free SSL – Free SSL Certificate for WordPress and force HTTPSWP Table Builder – WordPress Table PluginMedia Library File DownloadEasy Social Feed – Social Photos Gallery – Post Feed – Like BoxCheckout with Zelle on WoocommerceWP EmailyUnlimited Elements For Elementor (Free Widgets, Addons, Templates)Frontend Admin – Add and edit posts, pages, users and more all from the frontendNicheBaseLimb Gallery | Create Beautiful Image & Video GalleriesRevivePress – Keep your Old Content EvergreenPixel Manager for WooCommerce – Track Google Analytics, Google Ads, TikTok and morePostcode RedirectW3SCloud Contact Form 7 to Zoho CRMShared Files – Frontend File Upload Form & Secure File SharingGrid & Styler For Contact Form 7 And DiviBlock, Suspend, Report for BuddyPressКнопка ЮMoneyChange Price Title for WooCommerceForceFieldHide Shipping Method For WooCommerceWordPress SEO ChecklistEvents Addon for ElementorSend Prebuilt EmailsWP Encryption – One Click Free SSL Certificate & SSL / HTTPS Redirect to Force HTTPS, Security+Appointment & Event Booking Calendar Plugin – Webba BookingDelete Duplicate PostsAlt ManagerJoli FAQ SEO – WordPress FAQ PluginChange Prices with Time for WooCommerceAdvanced Page Visit Counter – Most Wanted Analytics Plugin for WordPressKRSP Frontend File UploaderPay For Post with WooCommerceWooCommerce Bulk Edit Coupons – WP Sheet EditorPosts List Designer by Category – List Category Posts Or Recent PostsLocalSEOMapGFireM Action AfterBookPress – For Book AuthorsAdd Expires Headers & Optimized MinifyCoupon Affiliates – Affiliate Plugin for WooCommerceWP Activity LogDivi Content RestrictorCartoon UrlEvents Calendar RegistrationSecure IP LoginsShare This ImageDashy – Google Analytics advanced dashboardAmelaWordPress Dev Powers – ACF Color Coded Field Types PluginGutenberg Blocks – ACF Blocks SuiteScrollsequence – Cinematic Scroll Image Animation PluginPayment Gateway for PayFabricRankBearAwesome SSLFeatured Products First for WooCommerce – A Extension of WooCommerce (WooCommerce Addon Plugin)South Pole: Climate action nowPremmerce User RolesAdd Twitter Pixel for Twitter adsQuote for WooCommerce Lite – Add to Quote Plugin Lets Customers Request Custom Quotes for Products using the Request a Quote Plugin for WooCommerceAvailability datepicker – Integrate with Contact Form 7 and DiviWooCommerce PayPlugWPBITS Addons For Elementor Page BuilderWP SMS Plugin – WordPress SMS Two Factor Authentication – 2FA, Two Factor, OTP SMS and EmailFullscreen MenuFuse Social Floating SidebarVideopackmyCred – Loyalty Points and Rewards plugin for WordPress and WooCommerce – Give Points, Ranks, Badges, Cashback, WooCommerce rewards, and WooCommerce credits for GamificationBlock Styler For Gravity FormsPremmerce Wholesale Pricing for WooCommerceBook BuyBack PricesProduct Customer List for WooCommerceGift Message for WooCommerceEasy PrayerPremmerce Multi-currency for WoocommerceQuick Paypal PaymentsMigrate WordPress Website & Backups – Prime MoverIks Menu – WordPress Category Accordion Menu & FAQsContact List – Premium Staff Listing, Business Directory Plugin & Address BookWordPress form builder plugin for contact forms, surveys and quizzes – TripettoUltimeterEthereum WalletSurveyFunnel – Survey Plugin for WordPressClickerVolt – Affiliate Links & Click Tracking for Performance MarketersWordPress Translation plugin for Post, Pages & WooCommerce products. Tranzly IO AI DeepL automatic WordPress Translator.azw woocommerce file uploadsDeMomentSomTres AddressWordPress Persistent LoginDrop Shadow BoxesGenerate Images – Magic Post ThumbnailAdFoxly – Ad Manager, AdSense Ads & Ads.txtRemove Add to Cart WooCommerceDynamic Pricing and Discount Rules for WooCommerceRadio Player – Live Shoutcast, Icecast and Any Audio Stream Player for WordPressWCC SEO Keyword ResearchFAQ Manager For Divi, Gutenberg Block & ShortcodeAny Popup – Popup Forms, Optins & AdsWadi SurveySlideDeck: Responsive WordPress Slider PluginDocument Viewer- Plugin to Display MS Office DocsXT Quick View for WooCommercePlace Order Without Payment for WooCommerceBetter SharingTeam Collaboration Plugin for WordPress Editorial teams- MulticollabWP Travel Engine – Tour Booking Plugin – Tour Operator SoftwareBetter Elementor AddonsQuick Event ManagerRun Contests, Raffles, and Giveaways with ContestsWPSKT Templates – 100% free Elementor & Gutenberg templatesDelivery for WooCommerceQuick Contact FormFAQ / Accordion / Docs – Helpie WordPress FAQ Accordion pluginRocket Maintenance Mode & Coming Soon PageEther and ERC20 tokens WooCommerce Payment GatewayWPVisitorInfo – Show Visitor Information & Conditional Data Based On That InformationHM Multiple RolesUltimate Carousel For DiviAFI – The Easiest Integration PluginWP MooseFraud Prevention For WooCommerce and EDDBest Responsive Comparison Table for Gutenberg Editor – NicheTableAdd Tiktok Pixel for Tiktok ads (+Woocommerce)Contact Widgets For Elementor all the contact links you need in one placeProtect Uploads with Login – Protect Your UploadsBulk Edit and Create User Profiles – WP Sheet EditorDa ReactionsMass Pages/Posts CreatorWholesale for WooCommerce — This Wholesale Plugin Helps B2B and B2C Businesses Streamline Wholesale Products, Pricing, and User Roles, Automating their WooCommerce Wholesale StoresQuick Affiliate StoreWordPress Animation Plugin – Animated EverythingWPBakery Page Builder Addons by LivemeshProduct Attachment for WooCommerceAnnouncement & Notification Banner – BulletinAll-in-One Video GallerySocial Gallery LiteRun time Image resizingWUPO Group Attributes for WooCommerceMapGeo – Interactive Geo MapsPinblocks — Gutenberg blocks with Pinterest widgetsDivi Torque Lite – Divi Theme and Extra ThemeSocialMark – Easy Watermark/Logo on Social Media Post Link Share PreviewSQL Reporting Services – SSRS Plugin for WordPressGet Directions MapCaxton – Create Pro page layouts in GutenbergAnt Admin Notices for TeamBetter Messages – WCFM IntegrationZip Code RedirectRedirection for Contact Form 7Custom Login Page CustomizerGet Better Reviews for WooCommerceNew User ApproveTurbo WidgetsMobile View for Responsive web design optimization (UX design) + Mobile Friendly TestThank You Page for WooCommerceBuilder for WooCommerce product reviews shortcodes – ReviewShortkk Star Ratings – Rate Post & Collect User FeedbacksLogo Showcase – Responsive Logo Carousel, Logo Slider & Logo GridRaCar Clear Cart for WooCommerceDeMomentSomTres Media Tools AutoWordPress Google TranslateEasy Tiktok FeedModern Designs for Gravity FormsEasy Math Captcha for CF7Filr – Secure document libraryPreloader for DiviMeridiaWidget Detector for ElementorBrandAutomatic YouTube GalleryRest Routes – Custom Endpoints for WordPress REST APIPurosaYatri ToolsWoowGallery – image gallery / content gallery / ecommerce gallery / social gallery / video gallery / album photo galleryWP Required Taxonomies – Categories and Tags MandatoryWordPress Books GalleryWP Disable SitemapAdd Linkedin insight tags for Linkedin adsProduct Image Watermark for WooFooter Plugin for DiviOverlay Image Divi ModuleDuplicate Variations for WoocommerceWooCommerce Google Analytics Integration By Advanced WC AnalyticsDrip Feed Content Extended for LearndashError Log MonitorBlog Grid & Post Grid – Blog Post Slider, Blog Post Carousel, Blog Post Ticker, Blog Post Masonry, Category Post Grid By News & Blog Designer PackPremmerce Product Search for WooCommerceYASR – Yet Another Star Rating Plugin for WordPressMultisite Robots.txt ManagerInternal Linking for SEO traffic & Ranking – Auto internal links (100% automatic)Woo Admin Product NotesRoyal Elementor Addons and TemplatesSnazzyAdmin WP Admin ThemeSocial KitwGauge – Free VersionElementor Addon ElementsWooCommerce Country Catalogs – Product Country RestrictionsWordPress SEO Audit Plugin – WP Site AuditorWP Tools Divi Product CarouselAds.txt & App-ads.txt Manager for WordPressSimple SponsorshipsKikote – Location Picker at Checkout & Google Address AutoFill Plugin for WooCommerceWP Page TemplatesGuest posting / Frontend Posting wordpress plugin – WP Front User Submit / Front EditorWordPress WooCommerce Sync for Google SheetBooking Calendar | Appointment Booking | BookitFlat Rate Shipping Plugin For WooCommerceGuestofy – Restaurant Reservations Plugin, Room Planer, Reservation FormWP Link BioWordPress Dev Powers – Element Selector jQuery Powers PluginFull Page Blog DesignerTwentyFourth WP ScraperBlock Slider – Responsive Image Slider, Video Slider & Post SliderEnhanced Ecommerce Google Analytics for WooCommerceWidget for Contact form 7Stackable – Page Builder Gutenberg BlocksSimple Feature Requests Free – User Feedback BoardBlockyPage – Gutenberg Based Page BuilderWP AutoMedicGallery PhotoBlocksContact Form 7 – Capsule CRM – IntegrationEvent Tickets and RegistrationEasy Settings for LearnDashWordPress Auto SEO Plugin – Upfiv SEO WizardWP Relevant AdsForms to Zapier, Integromat, IFTTT, Workato, Automate.io, elastic.io, Built.io, APIANT, WebhookUser Menus – Nav Menu VisibilityLittleBot ACH for Stripe + PlaidUnder ConstructionMaster Accordion ( Former WP Awesome FAQ Plugin )XT Points & Rewards for WooCommerceCF7 Constant Contact Fields MappingWP Data Access – WordPress App, Table and Form Builder pluginPassster – Password Protect Pages and ContentOut of stock display for woocommerceClean Social IconsCheckout with Cash App on EDDAutoSave NetSSL Certificate – Free SSL, HTTPS by SSL ZenGateway for PayLate on WooCommerceCourt Reservation – Manage Your Court Bookings OnlineAffiliate Link Builder Plugin for Amazon Associates – Review EngineAdvanced Custom Fields options import/exportRT Easy Builder – Advanced addons for ElementorThe best plugin for restrict content, support all Custom Post Types and Elementor – Password ProtectedChoice Payment Gateway for WooCommerceURL Shortify – Simple, Powerful and Easy URL Shortener Plugin For WordPressWooCommerce Shipping gateway per ProductWP Tools Divi Blog CarouselSimple Social Page Widget & ShortcodeUltimate Bulk SEO Noindex Nofollow – Speed up Penalty Recovery Ultimate SEO BoosterEducation Addon for ElementorAdvanced Classifieds & Directory ProCode ManagerHuCommerce | Magyar WooCommerce kiegészítésekFree Booking Plugin for Hotels, Restaurants and Car Rentals – eaSYNC BookingFeedpress Generator – External RSS Frontend CustomizerSTAX Header BuilderWP Google Street View (with 360° virtual tour) & Google maps + Local SEOUltimate Divi Modules Suite – Divi Sumo LiteWordPress Buffer – HYPESocial. Social Media Auto Post, Social Media Auto Publish and ScheduleFIT: Featured Image ToolkitConversion de moneda WoocommerceWP Adminify – Custom WordPress Dashboard, Login and Admin CustomizerGo Viral – social share, social sharebar, social locker, social chat, open graph, reactions, share & view countersWooCommerce Bulk Edit Products – WP Sheet EditorWP SierraWordPress Gallery Plugin – Edge Photo GalleryPootle Pagebuilder – WordPress Page builderTickera – WordPress Event Ticketing
CWE ID-CWE-862
Missing Authorization
CVE-2024-31423
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-4.3||MEDIUM
EPSS-0.24% / 47.16%
||
7 Day CHG~0.00%
Published-09 Jun, 2024 | 17:15
Updated-26 Sep, 2024 | 14:19
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress WP Accessibility Helper (WAH) plugin <= 0.6.2.5 - Broken Access Control vulnerability

Missing Authorization vulnerability in Alex Volkov WP Accessibility Helper (WAH).This issue affects WP Accessibility Helper (WAH): from n/a through 0.6.2.5.

Action-Not Available
Vendor-volkovAlex Volkovalex_volkov
Product-wp_accessibility_helperWP Accessibility Helper (WAH)wp_accessibility_helper
CWE ID-CWE-862
Missing Authorization
CVE-2024-32517
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-4.3||MEDIUM
EPSS-0.15% / 35.93%
||
7 Day CHG~0.00%
Published-17 Apr, 2024 | 07:38
Updated-02 Aug, 2024 | 02:13
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Custom Thank You Page Customize For WooCommerce by Binary Carpenter plugin <= 1.4.12 - Broken Access Control vulnerability

Missing Authorization vulnerability in WooCommerce & WordPress Tutorials Custom Thank You Page Customize For WooCommerce by Binary Carpenter.This issue affects Custom Thank You Page Customize For WooCommerce by Binary Carpenter: from n/a through 1.4.12.

Action-Not Available
Vendor-WooCommerce & WordPress Tutorials
Product-Custom Thank You Page Customize For WooCommerce by Binary Carpenter
CWE ID-CWE-862
Missing Authorization
CVE-2024-32455
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-4.3||MEDIUM
EPSS-0.11% / 30.75%
||
7 Day CHG~0.00%
Published-16 Apr, 2024 | 18:57
Updated-02 Aug, 2024 | 02:13
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Fatal Error Notify plugin <= 1.5.2 - Broken Access Control vulnerability

Missing Authorization vulnerability in Very Good Plugins Fatal Error Notify.This issue affects Fatal Error Notify: from n/a through 1.5.2.

Action-Not Available
Vendor-Very Good Plugins
Product-Fatal Error Notify
CWE ID-CWE-862
Missing Authorization
CVE-2024-30217
Matching Score-4
Assigner-SAP SE
ShareView Details
Matching Score-4
Assigner-SAP SE
CVSS Score-4.3||MEDIUM
EPSS-0.09% / 26.79%
||
7 Day CHG~0.00%
Published-09 Apr, 2024 | 01:03
Updated-02 Aug, 2024 | 01:25
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Missing Authorization check in SAP S/4 HANA (Cash Management)

Cash Management in SAP S/4 HANA does not perform necessary authorization checks for an authenticated user, resulting in escalation of privileges. By exploiting this vulnerability, an attacker can approve or reject a bank account application affecting the integrity of the application. Confidentiality and Availability are not impacted.

Action-Not Available
Vendor-SAP SE
Product-SAP S/4 HANA (Cash Management)
CWE ID-CWE-862
Missing Authorization
CVE-2020-15412
Matching Score-4
Assigner-MITRE Corporation
ShareView Details
Matching Score-4
Assigner-MITRE Corporation
CVSS Score-4.3||MEDIUM
EPSS-0.15% / 36.70%
||
7 Day CHG~0.00%
Published-30 Jun, 2020 | 13:15
Updated-04 Aug, 2024 | 13:15
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

An issue was discovered in MISP 2.4.128. app/Controller/EventsController.php lacks an event ACL check before proceeding to allow a user to send an event contact form.

Action-Not Available
Vendor-mispn/a
Product-mispn/a
CWE ID-CWE-862
Missing Authorization
CVE-2024-30216
Matching Score-4
Assigner-SAP SE
ShareView Details
Matching Score-4
Assigner-SAP SE
CVSS Score-4.3||MEDIUM
EPSS-0.07% / 21.89%
||
7 Day CHG~0.00%
Published-09 Apr, 2024 | 01:02
Updated-02 Aug, 2024 | 01:25
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Missing Authorization check in SAP S/4 HANA (Cash Management)

Cash Management in SAP S/4 HANA does not perform necessary authorization checks for an authenticated user, resulting in escalation of privileges. By exploiting this vulnerability, attacker can add notes in the review request with 'completed' status affecting the integrity of the application. Confidentiality and Availability are not impacted.

Action-Not Available
Vendor-SAP SE
Product-SAP S/4 HANA (Cash Management)
CWE ID-CWE-862
Missing Authorization
CVE-2024-31267
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-4.3||MEDIUM
EPSS-0.22% / 44.55%
||
7 Day CHG~0.00%
Published-09 Jun, 2024 | 11:14
Updated-01 Nov, 2024 | 14:10
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Flexible Checkout Fields for WooCommerce plugin <= 4.1.2 - Broken Access Control vulnerability

Missing Authorization vulnerability in WP Desk Flexible Checkout Fields for WooCommerce.This issue affects Flexible Checkout Fields for WooCommerce: from n/a through 4.1.2.

Action-Not Available
Vendor-wpdeskWP Desk
Product-flexible_checkout_fieldsFlexible Checkout Fields for WooCommerce
CWE ID-CWE-862
Missing Authorization
CVE-2024-30537
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-4.3||MEDIUM
EPSS-0.22% / 44.55%
||
7 Day CHG~0.00%
Published-09 Jun, 2024 | 09:01
Updated-02 Aug, 2024 | 01:38
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress WPC Badge Management for WooCommerce plugin <= 2.4.0 - Broken Access Control vulnerability

Missing Authorization vulnerability in WPClever WPC Badge Management for WooCommerce.This issue affects WPC Badge Management for WooCommerce: from n/a through 2.4.0.

Action-Not Available
Vendor-wpcleverWPClever
Product-wpc_badge_management_for_woocommerceWPC Badge Management for WooCommerce
CWE ID-CWE-862
Missing Authorization
CVE-2024-30528
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-5.4||MEDIUM
EPSS-0.08% / 23.73%
||
7 Day CHG~0.00%
Published-04 Jun, 2024 | 19:19
Updated-02 Aug, 2024 | 01:38
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Spiffy Calendar plugin <= 4.9.10 - Broken Access Control vulnerability

Missing Authorization vulnerability in Spiffy Plugins Spiffy Calendar.This issue affects Spiffy Calendar: from n/a through 4.9.10.

Action-Not Available
Vendor-spiffypluginsSpiffy Plugins
Product-spiffy_calendarSpiffy Calendar
CWE ID-CWE-862
Missing Authorization
CVE-2024-30517
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-4.3||MEDIUM
EPSS-0.22% / 44.55%
||
7 Day CHG~0.00%
Published-09 Jun, 2024 | 11:02
Updated-07 Oct, 2024 | 18:14
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Sliced Invoices plugin <= 3.9.2 - Broken Access Control vulnerability

Missing Authorization vulnerability in Sliced Invoices.This issue affects Sliced Invoices: from n/a through 3.9.2.

Action-Not Available
Vendor-slicedinvoicesSliced Invoices
Product-sliced_invoicesSliced Invoices
CWE ID-CWE-862
Missing Authorization
CVE-2020-15245
Matching Score-4
Assigner-GitHub, Inc.
ShareView Details
Matching Score-4
Assigner-GitHub, Inc.
CVSS Score-4.3||MEDIUM
EPSS-0.17% / 39.16%
||
7 Day CHG~0.00%
Published-19 Oct, 2020 | 20:50
Updated-04 Aug, 2024 | 13:08
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Email verification bypass in Sylius

In Sylius before versions 1.6.9, 1.7.9 and 1.8.3, the user may register in a shop by email mail@example.com, verify it, change it to the mail another@domain.com and stay verified and enabled. This may lead to having accounts addressed to totally different emails, that were verified. Note, that this way one is not able to take over any existing account (guest or normal one). The issue has been patched in Sylius 1.6.9, 1.7.9 and 1.8.3. As a workaround, you may resolve this issue on your own by creating a custom event listener, which will listen to the sylius.customer.pre_update event. You can determine that email has been changed if customer email and user username are different. They are synchronized later on. Pay attention, to email changing behavior for administrators. You may need to skip this logic for them. In order to achieve this, you should either check master request path info, if it does not contain /admin prefix or adjust event triggered during customer update in the shop. You can find more information on how to customize the event here.

Action-Not Available
Vendor-syliusSylius
Product-syliusSylius
CWE ID-CWE-79
Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')
CWE ID-CWE-862
Missing Authorization
CVE-2022-20614
Matching Score-4
Assigner-Jenkins Project
ShareView Details
Matching Score-4
Assigner-Jenkins Project
CVSS Score-4.3||MEDIUM
EPSS-2.21% / 83.79%
||
7 Day CHG~0.00%
Published-12 Jan, 2022 | 00:00
Updated-03 Aug, 2024 | 02:17
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

A missing permission check in Jenkins Mailer Plugin 391.ve4a_38c1b_cf4b_ and earlier allows attackers with Overall/Read access to use the DNS used by the Jenkins instance to resolve an attacker-specified hostname.

Action-Not Available
Vendor-Oracle CorporationJenkins
Product-communications_cloud_native_core_automated_test_suitemailerJenkins Mailer Plugin
CWE ID-CWE-862
Missing Authorization
CVE-2024-30484
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-4.3||MEDIUM
EPSS-0.22% / 44.55%
||
7 Day CHG~0.00%
Published-04 Jun, 2024 | 19:08
Updated-02 Aug, 2024 | 01:38
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress RT Easy Builder plugin <= 2.0 - Broken Access Control vulnerability

Missing Authorization vulnerability in RT Easy Builder – Advanced addons for Elementor.This issue affects RT Easy Builder – Advanced addons for Elementor: from n/a through 2.0.

Action-Not Available
Vendor-risethemes
Product-rt_easy_builderRT Easy Builder – Advanced addons for Elementor
CWE ID-CWE-862
Missing Authorization
CVE-2025-3915
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.3||MEDIUM
EPSS-0.05% / 14.97%
||
7 Day CHG+0.01%
Published-26 Apr, 2025 | 05:34
Updated-06 May, 2025 | 16:26
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Aeropage Sync for Airtable <= 3.2.0 - Missing Authorization to Authenticated (Subscriber+) Arbitrary Post Deletion

The Aeropage Sync for Airtable plugin for WordPress is vulnerable to unauthorized loss of data due to a missing capability check on the 'aeropageDeletePost' function in all versions up to, and including, 3.2.0. This makes it possible for authenticated attackers, with Subscriber-level access and above, to delete arbitrary posts.

Action-Not Available
Vendor-aeropageaeropage
Product-aeropage_sync_for_airtableAeropage Sync for Airtable
CWE ID-CWE-862
Missing Authorization
CVE-2022-45349
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-4.3||MEDIUM
EPSS-0.06% / 19.19%
||
7 Day CHG~0.00%
Published-25 Mar, 2024 | 11:18
Updated-31 Jan, 2025 | 14:12
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Betheme premium theme <= 26.6.1 - Broken Access Control vulnerability

Missing Authorization vulnerability in Muffingroup Betheme.This issue affects Betheme: from n/a through 26.6.1.

Action-Not Available
Vendor-Muffin Group
Product-bethemeBetheme
CWE ID-CWE-862
Missing Authorization
CVE-2022-45399
Matching Score-4
Assigner-Jenkins Project
ShareView Details
Matching Score-4
Assigner-Jenkins Project
CVSS Score-4.3||MEDIUM
EPSS-0.06% / 19.18%
||
7 Day CHG~0.00%
Published-15 Nov, 2022 | 00:00
Updated-30 Apr, 2025 | 16:15
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

A missing permission check in Jenkins Cluster Statistics Plugin 0.4.6 and earlier allows attackers to delete recorded Jenkins Cluster Statistics.

Action-Not Available
Vendor-Jenkins
Product-cluster_statisticsJenkins Cluster Statistics Plugin
CWE ID-CWE-862
Missing Authorization
CVE-2024-27900
Matching Score-4
Assigner-SAP SE
ShareView Details
Matching Score-4
Assigner-SAP SE
CVSS Score-4.3||MEDIUM
EPSS-0.12% / 31.80%
||
7 Day CHG~0.00%
Published-12 Mar, 2024 | 00:44
Updated-16 Apr, 2025 | 15:40
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Missing Authorization check in SAP ABAP Platform

Due to missing authorization check, attacker with business user account in SAP ABAP Platform - version 758, 795, can change the privacy setting of job templates from shared to private. As a result, the selected template would only be accessible to the owner.

Action-Not Available
Vendor-SAP SE
Product-abap_platformSAP ABAP Platform
CWE ID-CWE-862
Missing Authorization
CVE-2024-28159
Matching Score-4
Assigner-Jenkins Project
ShareView Details
Matching Score-4
Assigner-Jenkins Project
CVSS Score-4.3||MEDIUM
EPSS-0.07% / 22.80%
||
7 Day CHG~0.00%
Published-06 Mar, 2024 | 17:02
Updated-06 Jun, 2025 | 15:28
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

A missing permission check in Jenkins Subversion Partial Release Manager Plugin 1.0.1 and earlier allows attackers with Item/Read permission to trigger a build.

Action-Not Available
Vendor-Jenkins
Product-subversion_partial_release_managerJenkins Subversion Partial Release Manager Pluginsubversion_partial_release_manager
CWE ID-CWE-862
Missing Authorization
CVE-2022-45352
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-5.4||MEDIUM
EPSS-0.04% / 12.20%
||
7 Day CHG~0.00%
Published-25 Mar, 2024 | 11:21
Updated-31 Jan, 2025 | 14:25
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Betheme premium theme <= 26.6.1 - Broken Access Control vulnerability

Missing Authorization vulnerability in Muffingroup Betheme.This issue affects Betheme: from n/a through 26.6.1.

Action-Not Available
Vendor-Muffin Group
Product-bethemeBetheme
CWE ID-CWE-862
Missing Authorization
CVE-2024-2844
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.3||MEDIUM
EPSS-0.09% / 25.60%
||
7 Day CHG~0.00%
Published-29 Mar, 2024 | 05:35
Updated-05 Feb, 2025 | 21:03
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

The Easy Appointments plugin for WordPress is vulnerable to unauthorized modification of data due to insufficient user validation on the ajax_cancel_appointment() function in all versions up to, and including, 3.11.18. This makes it possible for unauthenticated attackers to cancel other users orders.

Action-Not Available
Vendor-easy-appointmentsloncareasyappointments
Product-easy_appointmentsEasy Appointmentseasyappointments
CWE ID-CWE-862
Missing Authorization
CVE-2022-43482
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-4.3||MEDIUM
EPSS-0.15% / 35.99%
||
7 Day CHG~0.00%
Published-18 Nov, 2022 | 19:03
Updated-20 Feb, 2025 | 19:52
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Appointment Booking Calendar plugin <= 1.3.69 - Missing Authorization vulnerability

Missing Authorization vulnerability in Appointment Booking Calendar plugin <= 1.3.69 on WordPress.

Action-Not Available
Vendor-CodePeople
Product-appointment_booking_calendarAppointment Booking Calendar (WordPress plugin)
CWE ID-CWE-862
Missing Authorization
CVE-2025-8482
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-4.3||MEDIUM
EPSS-0.03% / 6.66%
||
7 Day CHG~0.00%
Published-12 Aug, 2025 | 06:42
Updated-12 Aug, 2025 | 16:04
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Simple Local Avatars <= 2.8.4 - Missing Authorization to Authenticated (Subscriber+) Avatar Migration

The Simple Local Avatars plugin for WordPress is vulnerable to unauthorized modification of data in version 2.8.4. This is due to a missing capability check on the migrate_from_wp_user_avatar() function. This makes it possible for authenticated attackers, with subscriber-level access and above, to migrate avatar metadata for all users.

Action-Not Available
Vendor-10up
Product-Simple Local Avatars
CWE ID-CWE-862
Missing Authorization
CVE-2024-28004
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-5.4||MEDIUM
EPSS-0.10% / 29.15%
||
7 Day CHG~0.00%
Published-28 Mar, 2024 | 05:51
Updated-28 Jan, 2025 | 18:12
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Colibri Page Builder plugin <= 1.0.248 - Broken Access Control vulnerability

Missing Authorization vulnerability in ExtendThemes Colibri Page Builder.This issue affects Colibri Page Builder: from n/a through 1.0.248.

Action-Not Available
Vendor-extendthemesExtendThemesextendthemes
Product-colibri_page_builderColibri Page Buildercolibri_page_builder
CWE ID-CWE-862
Missing Authorization
CVE-2022-41995
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-4.3||MEDIUM
EPSS-0.08% / 24.88%
||
7 Day CHG~0.00%
Published-02 Jan, 2025 | 14:51
Updated-03 Jan, 2025 | 18:57
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Photo Gallery – Image Gallery by Ape Plugin <= 2.2.8 is vulnerable to Broken Access Control

Missing Authorization vulnerability in Galleryape Gallery Images Ape allows Exploiting Incorrectly Configured Access Control Security Levels.This issue affects Gallery Images Ape: from n/a through 2.2.8.

Action-Not Available
Vendor-Galleryape
Product-Gallery Images Ape
CWE ID-CWE-862
Missing Authorization
CVE-2022-41692
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-4.3||MEDIUM
EPSS-0.15% / 35.99%
||
7 Day CHG~0.00%
Published-18 Nov, 2022 | 18:54
Updated-20 Feb, 2025 | 19:52
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Appointment Hour Booking plugin <= 1.3.71 - Missing Authorization vulnerability

Missing Authorization vulnerability in Appointment Hour Booking plugin <= 1.3.71 on WordPress.

Action-Not Available
Vendor-CodePeople
Product-appointment_hour_bookingAppointment Hour Booking (WordPress plugin)
CWE ID-CWE-862
Missing Authorization
CVE-2024-25908
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-4.3||MEDIUM
EPSS-0.13% / 33.84%
||
7 Day CHG~0.00%
Published-21 Mar, 2024 | 17:39
Updated-01 Aug, 2024 | 23:52
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress WP Media folder plugin <= 5.7.2 - Subscriber+ Arbitrary Post/Page Modification vulnerability

Missing Authorization vulnerability in JoomUnited WP Media folder.This issue affects WP Media folder: from n/a through 5.7.2.

Action-Not Available
Vendor-JoomUnited
Product-WP Media folder
CWE ID-CWE-862
Missing Authorization
CVE-2022-4148
Matching Score-4
Assigner-WPScan
ShareView Details
Matching Score-4
Assigner-WPScan
CVSS Score-4.3||MEDIUM
EPSS-0.05% / 15.82%
||
7 Day CHG~0.00%
Published-20 Mar, 2023 | 15:52
Updated-26 Feb, 2025 | 19:15
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WP OAuth Server < 4.3.0 - Subscriber+ Arbitrary Client Deletion

The WP OAuth Server (OAuth Authentication) WordPress plugin before 4.3.0 has a flawed CSRF and authorisation check when deleting a client, which could allow any authenticated users, such as subscriber to delete arbitrary client.

Action-Not Available
Vendor-dash10Unknown
Product-oauth_serverWP OAuth Server (OAuth Authentication)
CWE ID-CWE-352
Cross-Site Request Forgery (CSRF)
CWE ID-CWE-862
Missing Authorization
CVE-2023-0720
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-5.4||MEDIUM
EPSS-0.05% / 14.58%
||
7 Day CHG~0.00%
Published-08 Feb, 2023 | 01:03
Updated-07 Nov, 2023 | 04:01
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

The Wicked Folders plugin for WordPress is vulnerable to authorization bypass due to a missing capability check on the ajax_save_folder_order function in versions up to, and including, 2.18.16. This makes it possible for authenticated attackers, with subscriber-level permissions and above, to invoke this function and perform actions intended for administrators such as modifying the folder structure maintained by the plugin.

Action-Not Available
Vendor-wickedpluginswickedplugins
Product-wicked_foldersWicked Folders
CWE ID-CWE-862
Missing Authorization
CVE-2024-24719
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-4.3||MEDIUM
EPSS-0.13% / 32.92%
||
7 Day CHG~0.00%
Published-26 Mar, 2024 | 11:31
Updated-02 Aug, 2024 | 17:30
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Kikote plugin <= 1.8.9 - Broken Access Control vulnerability

Missing Authorization vulnerability in Uriahs Victor Location Picker at Checkout for WooCommerce.This issue affects Location Picker at Checkout for WooCommerce: from n/a through 1.8.9.

Action-Not Available
Vendor-Uriahs Victor
Product-Location Picker at Checkout for WooCommerce
CWE ID-CWE-862
Missing Authorization
CVE-2024-24739
Matching Score-4
Assigner-SAP SE
ShareView Details
Matching Score-4
Assigner-SAP SE
CVSS Score-6.3||MEDIUM
EPSS-0.11% / 29.87%
||
7 Day CHG~0.00%
Published-13 Feb, 2024 | 02:34
Updated-09 May, 2025 | 18:29
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Missing authorization check in SAP BAM (Bank Account Management)

SAP Bank Account Management (BAM) allows an authenticated user with restricted access to use functions which can result in escalation of privileges with low impact on confidentiality, integrity and availability of the application.

Action-Not Available
Vendor-SAP SE
Product-bank_account_managementSAP BAM (Bank Account Management)
CWE ID-CWE-862
Missing Authorization
CVE-2022-41790
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-4.3||MEDIUM
EPSS-0.10% / 28.40%
||
7 Day CHG~0.00%
Published-17 Jan, 2024 | 18:13
Updated-17 Jun, 2025 | 21:19
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress WP Time Slots Booking Form Plugin <= 1.1.76 is vulnerable to Broken Access Control

Missing Authorization vulnerability in CodePeople WP Time Slots Booking Form.This issue affects WP Time Slots Booking Form: from n/a through 1.1.76.

Action-Not Available
Vendor-CodePeople
Product-wp_time_slots_booking_formWP Time Slots Booking Form
CWE ID-CWE-862
Missing Authorization
CVE-2024-25935
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-4.3||MEDIUM
EPSS-0.28% / 50.63%
||
7 Day CHG~0.00%
Published-21 Mar, 2024 | 17:31
Updated-03 Feb, 2025 | 21:58
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress RegistrationMagic plugin <= 5.2.5.9 - Broken Access Control vulnerability

Missing Authorization vulnerability in Metagauss RegistrationMagic.This issue affects RegistrationMagic: from n/a through 5.2.5.9.

Action-Not Available
Vendor-Metagauss Inc.
Product-registrationmagicRegistrationMagic
CWE ID-CWE-862
Missing Authorization
CVE-2024-24718
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-4.3||MEDIUM
EPSS-0.13% / 32.92%
||
7 Day CHG~0.00%
Published-26 Mar, 2024 | 11:33
Updated-31 Jan, 2025 | 18:23
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress PropertyHive plugin <= 2.0.6 - Missing Authorization to Non-Arbitrary Plugin Installation vulnerability

Missing Authorization vulnerability in PropertyHive.This issue affects PropertyHive: from n/a through 2.0.6.

Action-Not Available
Vendor-wp-property-hivePropertyHive
Product-propertyhivePropertyHive
CWE ID-CWE-862
Missing Authorization
CVE-2025-32237
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-4.3||MEDIUM
EPSS-0.05% / 14.26%
||
7 Day CHG~0.00%
Published-04 Apr, 2025 | 15:59
Updated-07 Apr, 2025 | 14:18
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress MasterStudy LMS plugin <= 3.5.23 - Broken Access Control vulnerability

Missing Authorization vulnerability in Stylemix MasterStudy LMS allows Exploiting Incorrectly Configured Access Control Security Levels. This issue affects MasterStudy LMS: from n/a through 3.5.23.

Action-Not Available
Vendor-Stylemix
Product-MasterStudy LMS
CWE ID-CWE-862
Missing Authorization
  • Previous
  • 1
  • 2
  • 3
  • 4
  • ...
  • 17
  • 18
  • Next
Details not found