Logo
-

Byte Open Security

(ByteOS Network)

Log In

Sign Up

ByteOS

Security
Vulnerability Details
Registries
Custom Views
Weaknesses
Attack Patterns
Filters & Tools
Vulnerability Details :

CVE-2024-31248

Summary
Assigner-Patchstack
Assigner Org ID-21595511-bba5-4825-b968-b78d1f9984a3
Published At-09 Jun, 2024 | 11:10
Updated At-02 Aug, 2024 | 01:46
Rejected At-
Credits

WordPress All-in-One Video Gallery plugin <= 3.5.2 - Broken Access Control vulnerability

Missing Authorization vulnerability in Team Plugins360 All-in-One Video Gallery.This issue affects All-in-One Video Gallery: from n/a through 3.5.2.

Vendors
-
Not available
Products
-
Metrics (CVSS)
VersionBase scoreBase severityVector
Weaknesses
Attack Patterns
Solution/Workaround
References
HyperlinkResource Type
EPSS History
Score
Latest Score
-
N/A
No data available for selected date range
Percentile
Latest Percentile
-
N/A
No data available for selected date range
Stakeholder-Specific Vulnerability Categorization (SSVC)
▼Common Vulnerabilities and Exposures (CVE)
cve.org
Assigner:Patchstack
Assigner Org ID:21595511-bba5-4825-b968-b78d1f9984a3
Published At:09 Jun, 2024 | 11:10
Updated At:02 Aug, 2024 | 01:46
Rejected At:
▼CVE Numbering Authority (CNA)
WordPress All-in-One Video Gallery plugin <= 3.5.2 - Broken Access Control vulnerability

Missing Authorization vulnerability in Team Plugins360 All-in-One Video Gallery.This issue affects All-in-One Video Gallery: from n/a through 3.5.2.

Affected Products
Vendor
Team Plugins360
Product
All-in-One Video Gallery
Collection URL
https://wordpress.org/plugins
Package Name
all-in-one-video-gallery
Default Status
unaffected
Versions
Affected
  • From n/a through 3.5.2 (custom)
    • -> unaffectedfrom3.6.0
Problem Types
TypeCWE IDDescription
CWECWE-862CWE-862 Missing Authorization
Type: CWE
CWE ID: CWE-862
Description: CWE-862 Missing Authorization
Metrics
VersionBase scoreBase severityVector
3.14.3MEDIUM
CVSS:3.1/AV:N/AC:L/PR:L/UI:N/S:U/C:L/I:N/A:N
Version: 3.1
Base score: 4.3
Base severity: MEDIUM
Vector:
CVSS:3.1/AV:N/AC:L/PR:L/UI:N/S:U/C:L/I:N/A:N
Metrics Other Info
Impacts
CAPEC IDDescription
Solutions

Update to 3.6.0 or a higher version.

Configurations

Workarounds

Exploits

Credits

finder
emad (Patchstack Alliance)
Timeline
EventDate
Replaced By

Rejected Reason

References
HyperlinkResource
https://patchstack.com/database/vulnerability/all-in-one-video-gallery/wordpress-all-in-one-video-gallery-plugin-3-5-2-broken-access-control-vulnerability?_s_id=cve
vdb-entry
Hyperlink: https://patchstack.com/database/vulnerability/all-in-one-video-gallery/wordpress-all-in-one-video-gallery-plugin-3-5-2-broken-access-control-vulnerability?_s_id=cve
Resource:
vdb-entry
▼Authorized Data Publishers (ADP)
1. CISA ADP Vulnrichment
Affected Products
Metrics
VersionBase scoreBase severityVector
Metrics Other Info
Impacts
CAPEC IDDescription
Solutions

Configurations

Workarounds

Exploits

Credits

Timeline
EventDate
Replaced By

Rejected Reason

References
HyperlinkResource
2. CVE Program Container
Affected Products
Metrics
VersionBase scoreBase severityVector
Metrics Other Info
Impacts
CAPEC IDDescription
Solutions

Configurations

Workarounds

Exploits

Credits

Timeline
EventDate
Replaced By

Rejected Reason

References
HyperlinkResource
https://patchstack.com/database/vulnerability/all-in-one-video-gallery/wordpress-all-in-one-video-gallery-plugin-3-5-2-broken-access-control-vulnerability?_s_id=cve
vdb-entry
x_transferred
Hyperlink: https://patchstack.com/database/vulnerability/all-in-one-video-gallery/wordpress-all-in-one-video-gallery-plugin-3-5-2-broken-access-control-vulnerability?_s_id=cve
Resource:
vdb-entry
x_transferred
Information is not available yet
▼National Vulnerability Database (NVD)
nvd.nist.gov
Source:audit@patchstack.com
Published At:09 Jun, 2024 | 12:15
Updated At:02 Dec, 2024 | 14:03

Missing Authorization vulnerability in Team Plugins360 All-in-One Video Gallery.This issue affects All-in-One Video Gallery: from n/a through 3.5.2.

CISA Catalog
Date AddedDue DateVulnerability NameRequired Action
N/A
Date Added: N/A
Due Date: N/A
Vulnerability Name: N/A
Required Action: N/A
Metrics
TypeVersionBase scoreBase severityVector
Secondary3.14.3MEDIUM
CVSS:3.1/AV:N/AC:L/PR:L/UI:N/S:U/C:L/I:N/A:N
Primary3.18.8HIGH
CVSS:3.1/AV:N/AC:L/PR:L/UI:N/S:U/C:H/I:H/A:H
Type: Secondary
Version: 3.1
Base score: 4.3
Base severity: MEDIUM
Vector:
CVSS:3.1/AV:N/AC:L/PR:L/UI:N/S:U/C:L/I:N/A:N
Type: Primary
Version: 3.1
Base score: 8.8
Base severity: HIGH
Vector:
CVSS:3.1/AV:N/AC:L/PR:L/UI:N/S:U/C:H/I:H/A:H
CPE Matches

plugins360
plugins360
>>all-in-one_video_gallery>>Versions before 3.6.0(exclusive)
cpe:2.3:a:plugins360:all-in-one_video_gallery:*:*:*:*:*:wordpress:*:*
Weaknesses
CWE IDTypeSource
CWE-862Secondaryaudit@patchstack.com
CWE ID: CWE-862
Type: Secondary
Source: audit@patchstack.com
Evaluator Description

Evaluator Impact

Evaluator Solution

Vendor Statements

References
HyperlinkSourceResource
https://patchstack.com/database/vulnerability/all-in-one-video-gallery/wordpress-all-in-one-video-gallery-plugin-3-5-2-broken-access-control-vulnerability?_s_id=cveaudit@patchstack.com
Third Party Advisory
https://patchstack.com/database/vulnerability/all-in-one-video-gallery/wordpress-all-in-one-video-gallery-plugin-3-5-2-broken-access-control-vulnerability?_s_id=cveaf854a3a-2127-422b-91ae-364da2661108
Third Party Advisory
Hyperlink: https://patchstack.com/database/vulnerability/all-in-one-video-gallery/wordpress-all-in-one-video-gallery-plugin-3-5-2-broken-access-control-vulnerability?_s_id=cve
Source: audit@patchstack.com
Resource:
Third Party Advisory
Hyperlink: https://patchstack.com/database/vulnerability/all-in-one-video-gallery/wordpress-all-in-one-video-gallery-plugin-3-5-2-broken-access-control-vulnerability?_s_id=cve
Source: af854a3a-2127-422b-91ae-364da2661108
Resource:
Third Party Advisory

Change History

0
Information is not available yet

Similar CVEs

739Records found

CVE-2024-4670
Matching Score-8
Assigner-Wordfence
ShareView Details
Matching Score-8
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-0.45% / 62.66%
||
7 Day CHG~0.00%
Published-15 May, 2024 | 12:46
Updated-01 Aug, 2024 | 20:47
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
All-in-One Video Gallery <= 3.6.5 - Authenticated (Contributor+) Local File Inclusion via aiovg_search_form Shortcode

The All-in-One Video Gallery plugin for WordPress is vulnerable to Local File Inclusion in all versions up to, and including, 3.6.5 via the aiovg_search_form shortcode. This makes it possible for authenticated attackers, with contributor-level access and above, to include and execute arbitrary files on the server, allowing the execution of any PHP code in those files. This can be used to bypass access controls, obtain sensitive data, or achieve code execution in cases where images and other “safe” file types can be uploaded and included.

Action-Not Available
Vendor-plugins360plugins360
Product-All-in-One Video Galleryall-in-one_video_gallery
CVE-2024-4033
Matching Score-8
Assigner-Wordfence
ShareView Details
Matching Score-8
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-7.00% / 91.08%
||
7 Day CHG~0.00%
Published-02 May, 2024 | 16:52
Updated-01 Aug, 2024 | 20:26
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
All-in-One Video Gallery <= 3.6.4 - Authenticated (Contributor+) Arbitrary File Upload via featured image

The All-in-One Video Gallery plugin for WordPress is vulnerable to arbitrary file uploads due to missing file type validation in the aiovg_create_attachment_from_external_image_url function in all versions up to, and including, 3.6.4. This makes it possible for authenticated attackers, with contributor access and above, to upload arbitrary files on the affected site's server which may make remote code execution possible.

Action-Not Available
Vendor-plugins360
Product-All-in-One Video Gallery
CVE-2022-4974
Matching Score-6
Assigner-Wordfence
ShareView Details
Matching Score-6
Assigner-Wordfence
CVSS Score-6.3||MEDIUM
EPSS-0.07% / 22.12%
||
7 Day CHG~0.00%
Published-16 Oct, 2024 | 06:43
Updated-16 Oct, 2024 | 18:06
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Freemius SDK <= 2.4.2 - Missing Authorization Checks

The Freemius SDK, as used by hundreds of WordPress plugin and theme developers, was vulnerable to Cross-Site Request Forgery and Information disclosure due to missing capability checks and nonce protection on the _get_debug_log, _get_db_option, and the _set_db_option functions in versions up to, and including 2.4.2. Any WordPress plugin or theme running a version of Freemius less than 2.4.3 is vulnerable.

Action-Not Available
Vendor-wpscriptskokomowebstylingwebbenrenaudbodedgegallerypluginwpcohortpippozanardopagebuildersandwichsmusman98muhammad-rehmansslzentauhidprofastaf/jetixwpdanielealessandrapagupthemeseidvizheniawpconedevbavokoservicesjanthielemannskshaikatwpt00lsmarviorochabouncingsproutmberdingcliffpaulickbfintalcodeiesmilukovemdedevsamuelsilvaptstarfishwptonyzeoliw3scloudpootlepress/fullworkswpbitslinekalcodexonicsdanish-alilostboy7benmoreassyntwpvibesdaniyalahmedkolezhyk5webmuehledarellxjohnyklukeseagerthemestystreamweaselswphrmanagerzerozendesignivanchernyakov9brada6tobias_conrad/bestpluginswordpressbadhonrockspootlepressmatthias-reutertribalnerdalanfullerthemeythemeswp-makingtycoon12344iksstudiorankbearspartacscrollsequencemajicklkoudalankitmaruwptbtobias_conradjosevegadangub86moomooagencytheafricanboss/attestimtiazrayhanmaciejbak85cebbipaulio21ahmed17galoovercommercepunditwebheadllceedeeivan_paulinkitforesttickerakhothemeschetmacmodulemasterstprintyedisonaveclosemarketing/gowebsmartymarcqueraltchillichalliwhiteshadowsalttechnowptravelenginepmbaldha/sslatlasdrosendobradvinalphabposerviceatakanozlitonice13unitecmskairashabticleverpluginssjavedrichard-bgloriousthemespowerfulwpstevehentyjkohlbachmohammedrezqpeterschulznlprinceahmedkitthemesmunirkamalandyabelowsamdanidiviframeworkcreativethemeshqversacompgfiremdudokrspsj_oaharonyanmvvapps/davidandersonoceanwppassionatebrainscodesavoryxplodedthemeslivemeshsindyakinsergeimattpramschuferswitcorpwpdeliciousdgwyergiladtakoniclickervoltwpschoolcalendarprotectyouruploadsjburleigh1rafalosinskijohnc1979anfrageformularclosemarketingcypressnorthequalizedigitalalleythemeswoodyhaydayoceasrebelcodepopeatingaguilerasoftelliotvsdam6plekanathmilmorsonalsinha21dipcodeshelob9svenl77jurskicloudspongemaltathemesjwebsolpluginandplaywpcohort/pluginswarewgaugenpluginswppluginexpertsupfivdamian-goramelapresscodeatlanticwpeventpartners/wpexpertsioirkanuavidthemes/theafricanbossslidedeckweconnectcodeappexpertsioblocksparewiserstepssakurapixelinterfacelabmeowcrewmajick/ethereumicoioskymindsjavmahnicheaddonsalex-yerisethemeblockypagedjenhwpsoulfoxmoonmnelson4ggriesserwoopopsgallerycreatormumarym1985collizo4skysovstackthinleekpremmercewalkerwpsyntacticsgkher/wpgeniuzwpmagicssvovafwebtechstreetpatrickposnerggeddetranzlywpmunichtripettotakanakuiessekiaglowlogixmikebelsintoxstudiomojofywpwpdevpowersnasirahmedoloyede-jamiuthecodechimedreamfoxkylegilmanmantrabraininfosatechmhmrajibhiddenpearlsultimateblocksplugins360thijzienitin247infornwebtoddhalfpennymbrown24cloudlivingkkikuchi1220zeethemelimbcodeultradevsproteusthemesfsruslanpmbaldhaalexmossldninjas/vincoitactuaryzaskbilaltasdovypcmbibby/surbmakaizencodersdejanmarkovicmulticollabmohsinofflinesebetwpeka-clubalekvstevejburgepatrickgarmanjanwylcyberhoboarabianmidoivacykaggdesignroyalnavneetmcurlyusmanaliqureshijaydeep-nimavatbpluginsvinod-dalviseezeepenguininitiativesbeeneebmeepluginswupoxyulexbrandonfiredotsshawoninfoboriscolombier/paretodigitalvanyukovblockmeisterkartikparmar/ejslondon/maurolopes/kartechifyuriahs-victorronena100tropicalistagetsparrowcarlosmoreiraptvernaljcodexbycrikmte90halmatdeothemeswordpresschefdivisumofrostbourninvisnetprasadkirpekarninjalibsseancarricoannastaajwindshamim51staxwpmikewire_rocksolidmaxsdesignkartikparmarmihail-barinovibenicsebet/boltonstudiosmatstarstherealwebdisruptsmartwpressthemelocationkenanfallongreenjaymediacromer12bandidoelementinvaderwpchill5starpluginsmilukove/cadudecastroalvesh3technologieslynn999webba-agencymasterblockswordplussangaranco2okpasyukfrenifydotrexprelcsetkahqthemejamesparkninjaflexithemesdaigo75anssilaitilawpmoosebuttonizeranasbinmukimlistplussmgteamakdevsblackandwhitedigitalsnazzythemeswpengineelbisneroinputwphumblethemeswpdeverrafacarvalhidojack-kitterhingwpjolivohotv/Royal Elementor AddonsBdThemesThe Events Calendar (StellarWP)Themeisle
Product-Panorama Viewer- Best Plugin to Display Panoramic Images/VideosWooCommerce Variation Swatches for ProductsEasy Post Views CountWoocommerce Customer Reviews with Artificial Intelligence analyzis, with IBM Watson Tone AnalyzerOcean ExtraCodeKit – Custom Codes EditorForm Vibes – Database Manager for FormsGFireM Advance SearchSTEWoo – Super Transactional Emails for WooCommerceBlockMeister – Block Pattern BuilderWordPress Directory Plugin For Business Listings – WP Local PlusAirpressWP Sessions Time Monitoring Full AutomaticEmails Blacklist for Everest FormsSmart Floating / Sticky Buttons – Call, Sharing, Chat Widgets & More – ButtonizerExpire tagsXT Ajax Add To Cart for WooCommerceBefore and After Product Images for WooCommerceVillarWP Search FilterFunnelmentalsFrontend group restriction for LearnDashSEO BoosterTeam Members – A WordPress Team Plugin with Gallery, Grid, Carousel, Slider, Table, List, and MorePro Broken Links MaintainerPremmerce Product Filter for WooCommerceDancePress (TRWA)Walker CoreBAVOKO SEO Tools – All-in-One WordPress SEOWP Security Safejav&#039;s – WooCommerce and Trello integration WooTrelloWP School CalendarBooking Addon for WooCommerceStation ProProduct Carousel For WooCommerce – WoorouSellCartPops – High Converting Add To Cart Popup For WooCommerceGiveaways for woocommerceBuddyPress WooCommerce My Account Integration. Create WooCommerce Member PagesGreenshift – animation and page builder blocksAtlas – Knowledge BaseWP GratifyBetter Messages – Integration for WC Vendors MarketplaceBlocksy CompanionQyrr – simply and modern QR-Code creationannasta Woocommerce Product FiltersWP Tools Gravity Forms Divi ModuleTablesome – Form DB & Automation – WPForms, Contact Form 7, Elementor, Forminator, Fluent, GravityClimateClick: Climate Action for allA no-code page builder for beautiful performance-based contentArendelleMarket ExporterConnected SermonsLightbox & Modal Popup WordPress Plugin – FooBoxStarfish Review Generation & Marketing for WordPressWooCommerce Disable Payment Methods based on cart conditionsSticky add to cart for WooPost Slider and Post Carousel with Post Vertical Scrolling Widget – A Responsive Post SliderSecurity Ninja – Secure Firewall & Secure Malware ScannerPopOverXYZ – Show Light Weight Beautiful Tool Tips On Any TextEasy Age VerifyNotification Bar, Announcement and Cookie Notice WordPress Plugin – FooBarPremmerce Variation Swatches for WooCommerceProduct Size Charts Plugin for WooCommercePost Carousel DiviAge Verification Screen for WooCommerceSuper Video Player- Best WordPress Video Display Plugin for mp4/OGGSimple Giveaways – Grow your business, email lists and traffic with contestsHQTheme ExtraGlossaryAutomizy Gravity FormsExtend Filter Products By Price WidgetOrder and Inventory Manager for WooCommerceAdvanced Database ReplacerStore Toolkit – WooCommerce Extensions, Quick Enhancements & Handy ToolsLivemesh Addons for Beaver BuilderAbeta Link PunchOutMaster Blocks – Gutenberg Site BuilderPremmerce Permalink Manager for WooCommerceShipping Method Display Style for WooCommerceSpanish Market Enhancements for WooCommerceFeedbackScout: The easiest way to collect, prioritise, manage and track customer feedback.Restaurant & Cafe Addon for ElementorPost Form – Registration Form – Profile Form for User Profiles – Frontend Content Forms for User Submissions (UGC)WordPress Slider Block GutensliderWP Lead StreamAquarella LiteReally Simple Featured Video – Featured video support for Posts, Pages & WooCommerce ProductsVidSEO | WordPress Video SEO embedder with transcripts (Youtube & Vimeo)WPMailer – The best mail builder, No More Core for your emails support Elementor, CF7 forms etc…Multi Page Auto Advance for Gravity FormsTreePress – Easy Family Trees & Ancestor ProfilesCookie Consent for WP – Cookie Consent, Consent Log, Cookie Scanner, Script Blocker (for GDPR, CCPA & ePrivacy)3D Viewer – 3D Model Viewer PluginPurusDisplay Eventbrite EventsMedia Cloud for Bunny CDN, Amazon S3, Cloudflare R2, Google Cloud Storage, DigitalOcean and moreAPPExperts – Mobile App Builder for WordPress | WooCommerce to iOS and Android AppsWP Event Partners – WordPress Plugin for Event and Conference ManagementFloating Social Share Icons and Social Share buttons – Next Previous Post Links – FLPortfolio for Elementor & Image Gallery | PowerFolioWidgets for WooCommerce Products on ElementorStoreCustomizer – A plugin to Customize all WooCommerce PagesEmail Tracker – Email Tracking Plugin to track Emails for Open and Email Links Click (Compatible with WooCommerce)Prime Slider – Addons For Elementor (Revolution of a slider, Hero Slider, Ecommerce Slider)Custom WooCommerce Checkout Fields EditorEqualize Digital Accessibility Checker – Audit Your Website for WCAG, ADA, and Section 508 Accessibility ErrorsSalon Booking SystemWooCommerce EU VAT AssistantThe Events CalendarBulk Attachment DownloadListPlus – Unlimited Listing DirectoryMenu Item SchedulerWP Photo EffectsWordPress Reviews by ReviewPressAuto SEO META keywords (META tags keywords) optimization + WooCommerceJoli Table Of ContentsOne Click LoginEmail Header FooterBulk Auto Image Title Attribute (Image Title tag) optimizer (Image SEO)Woocommerce Customers Order HistoryImage Photo Gallery Final Tiles GridNitek Carousel Slider Cool TransitionsEasy Zillow ReviewsStreamCast – Radio Player for WordPressXT Variation Swatches for WooCommerceMenu Image, Icons made easyCryptocurrency Portfolio TrackerWS BootstrapWP Mobile Menu – The Mobile-Friendly Responsive MenuFast Checkout for WooCommerceSmart Variations Images & Swatches for WooCommerceMailChimp ManagerWp My Admin BarDeals of the Day WooCommerceHasiumResponsive Social Slider WidgetPage Builder Gutenberg Blocks – Kioken BlocksPage Builder Sandwich – Front End WordPress Page Builder PluginLivemesh SiteOrigin WidgetsViralikeCustom Registration and Custom Login Forms with New RecaptchaBattle Suit for DiviJDs PortfolioSV Proven ExpertVO Store Locator – WP Store Locator PluginReset Course Progress For LearnDashFront End PMRecurWP – WordPress Recurly Payment GatewayGlorious Services & SupportShubanIvory Search – WordPress Search PluginServer InfoBlog Sidebar WidgetAgy – Age verification for WooCommerceGoogle Analytics plugin for WordPress by GA4WPWP EasyPay – Square for WordPressWP Munich Blocks – Gutenberg Blocks for WordPressPremmerce Wishlist for WooCommerceNokkeBroadcast LiteWP Conference ScheduleEasy Newsletter SignupsAlley Business ToolkitReplyable – Subscribe to Comments and Reply by EmailNumber ChatCountry Based Payments for WooCommerceWebinar Solution: Create live/evergreen/automated/instant webinars, stream & Zoom Meetings | WebinarIgnitionSchema Plugin For Divi, Gutenberg & ShortcodesPower Ups for ElementorWordPress Everse Starter Sites – Elementor TemplatesContact Form 7 Multi-Step FormsAccept Stripe Donation and Payments – AidWPInternal Link Juicer: SEO Auto Linker for WordPressWoo UkrposhtaPage Builder for Gutenberg – StarterBlocksGet feedback from visitors – WP Feedback Suite PluginNEXUSBanner Management For WooCommerceScheduled Notification BarUltimate Blocks – WordPress Blocks PluginGenealogical Tree – WordPress Family TreeLearnMoreMaster Addons – Elementor Addons with White Label, Free Widgets, Hover Effects, Conditions, & AnimationsProduct Author for WooCommerceLightbox – EverlightBox GalleryImpexium Single Sign OnLive TV Player – Worldwide Live TV Channels Player for WordPressPrice Bands for WooCommerceVit Website ReviewsRevolution for ElementorGloriousThemes Starter SitesWordPress Robots.txt optimizer (+ XML Sitemap) – Boost SEO, Traffic & RankingsGallery Blocks with Lightbox. Image Gallery, (HTML5 video , YouTube, Vimeo) Video Gallery and Lightbox for native galleryGo Fetch Jobs (for WP Job Manager)Geo MashupFive-Star Ratings ShortcodeActivity Log For MainWPContent Aware Sidebars – Fastest Widget Area PluginBaniInsert or Embed Articulate Content into WordPressRadio Station by netmix® – Manage and play your Show Schedule in WordPress!Anfrageformular – Multi Step Drag & Drop Formular Builder – LeadgenerierungTabs with Recommended Posts (Widget)Performance KitWP BugBotTag Groups is the Advanced Way to Display Your Taxonomy TermsRW Divi Unite GalleryWP Get PersonalAdvance Menu ManagerBulk WooCommerce Category CreatorWP Delicious – Recipe Plugin for Food Bloggers (formerly Delicious Recipes)LawPress – Law Firm Website ManagementTinyMCE AnnotateElationElements for LifterLMSGFireM FieldsHooked Editable ContentConsultPress LiteFooGallery – Responsive Photo Gallery, Image Viewer, Justified, Masonry & CarouselCategorify – WordPress Media Library Category & File ManagerRestrict User Access – Ultimate Membership & Content ProtectionJustified GalleryLocal Delivery Drivers for WooCommerceStreamWeasels Twitch IntegrationFocus on Reviews for WooCommerceWP Frontend Admin – Display WP Admin Pages in the FrontendSimple Sitemap – Create a Responsive HTML SitemapOpenseaAdd Pinterest conversion tags for Pinterest Ads + Site verificationWordPress Coupon Plugin for Bloggers and Marketers – WP OffersCryptocurrency Product for WooCommerceFast WordPressExtra Fees Plugin for WooCommercePrint My Blog – Print, PDF, & eBook Converter WordPress PluginStreak CRM For Gmail For Contact Form 7 – WordPress PluginSpotlight Social Feeds – Block, Shortcode, and WidgetWP-HR Manager: The Human Resources Plugin for WordPressCAPTCHA 4WP – Antispam CAPTCHA solution for WordPressDeMomentSomTres Grid ArchiveTarot Card OracleIntegrate Google Drive – Browse, Upload, Download, Embed, Play, Share, Gallery, and Manage Your Google Drive Files into Your WordPress SiteWooCommerce Customers Table: View, Search, Bulk EditorChat Button- Leads and Order over ChatAll in One Invite CodesWP Meta and Date RemoverRating-Widget: Star Review SystemSurbma | GDPR Proof Cookie Consent & Notice BarEasy Code SnippetsComments Not Replied ToImage Carousel For DiviCuisine PalaceWP Radio – Worldwide Online Radio Stations Directory for WordPressElastaDivi CollageSparrow: Product Reviews and Ratings for WooCommerceSV Tracking ManagerUltra Elementor AddonsWooCommerce Next Order CouponWP Contact SliderLive Scores for SportsPressPast Events ExtensionTiered Pricing Table for WooCommerceAnyWhere ElementorWP Coupons and Deals – WordPress Coupon PluginSky Login RedirectWPTools Masonry Gallery & Posts For DiviNugget by Ingot: Easy, automated and native A/B testing for everyoneWP Post BlockEverseProduct Options and Price Calculation Formulas for WooCommerce – Uni CPOFeatured Images in RSS for Mailchimp & MoreFiboSearch – Ajax Search for WooCommercePost Snippets – Custom WordPress Code Snippets CustomizerWP Smart Export (Free)Coinbase Commerce – Crypto Gateway for WooCommerceWP Dev Powers – Display Screen Dimensions to Admin PluginSSL Atlas – Free SSL Certificate & HTTPS Redirect for WordPressWP fail2ban – Advanced Security PluginXT Floating Cart for WooCommerceAuthorize.Net Payment Gateway For WooCommerceDivi Forms Styler – Gravity Forms, Fluent Forms & Contact Form 7Multipurpose Gutenberg BlockFood Store – Online Food Delivery & PickupEthereumICOACF for WooCommerce ProductPremmerce Redirect ManagerDesign for Contact Form 7 Style WordPress Plugin – CF7 WOW StylerKVoucherSheetPress – Manage WordPress Meta data with Google SheetsLive Drag and Drop Builder for Contact Form 7Ultimate Widgets LightPodcast Box – Best Podcasting Plugin for WordPressBlocked in China | Check if your site is available in the Chinese mainlandWP Author BioWooCommerce upcoming ProductsPremmerce Brands for WooCommerceVideo Player for YouTubeDelete All Comments of wordpressDigital Goods for WooCommerce CheckoutBulk Edit Posts and Products in SpreadsheetMarijuana Age VerifyWordPress News Plugin – TopNewsWpPremmerce WooCommerce Customers ManagerCP Simple NewsletterWP Frontend ProfileEasy Smooth Scroll Links – Smooth Scrolling AnchorPremmerce SEO for WooCommerceLittleBot InvoicesFrontend Admin by DynamiAppsInbound BrewCheckout with Venmo on EDDUltimate Post Kit Addons For Elementor – (Post Grid, Post Carousel, Post Slider, Category List, Post Tabs, Timeline, Post Ticker, Tag Cloud)WC Shop Sync – Square Payment Gateway for WooCommerce, Inventory Sync Between Square and WooCommerce, Ultimate WooCommerce Square PluginBulk Auto Image Alt Text (Alt tag, Alt attribute) optimizer (image SEO)Restrict – membership, site, content and user access restrictions for WordPressTK SmugMug Slideshow ShortcodeWP-Cron Status CheckerStrumenti Partita IVA per WoocommerceElementor Addons by LivemeshPrimary Addon for ElementorbbResolutionsNinja Libs Amazon SESWP SPID ItaliaMusic Player for Elementor – Audio Player & Podcast PlayerKnowledge Base documentation & wiki plugin – BasePress DocsModern Addons for Elementor Page BuilderBetter Messages – Live Chat for WordPress, BuddyPress, PeepSo, Ultimate Member, BuddyBossWP Group PromoterWidgets on PagesSpreadsheet Integration – Automate Google Sheets With WordPress, WooCommerce & Most Popular Form Plugins. Also, Display Google sheet as a Table.SVG Flags – Beautiful Scalable Flags For All Countries!Anti-Spam by Fullworks : GDPR Compliant Spam ProtectionBulk Edit Categories and Tags – Create Thousands Quickly on the EditorDelete old Posts automaticallyPremmerceTop Bar – PopUps – by WPOptinLMS Plugin – eLearning, Online Courses by AttestPost to Google My Business (Google Business Profile)EthPress – Web3 LoginUnakitLicense Manager for WooCommerceSync eCommerce NEOTK Google Fonts GDPR CompliantWP Affiliate DisclosureBlockspare: Gutenberg Blocks & Patterns for Blogs, Magazines, Business Sites – Post Grids, Sliders, Carousels, Counters, Page Builder & Starter Site Imports, No Coding NeededSpeculorDomain Mapping System | Create Microsites with Multiple Alias Domains (multisite optional)Ultimate Gutenberg – Custom Block TemplatesWidgets on Pages and PostsPayment gateway per Product for WooCommerceWP Notification BellConeBlog – Elementor Blog WidgetsWP Free SSL – Free SSL Certificate for WordPress and force HTTPSWP Table Builder – WordPress Table PluginMedia Library File DownloadEasy Social Feed – Social Photos Gallery – Post Feed – Like BoxCheckout with Zelle on WoocommerceWP EmailyUnlimited Elements For Elementor (Free Widgets, Addons, Templates)Frontend Admin – Add and edit posts, pages, users and more all from the frontendNicheBaseLimb Gallery | Create Beautiful Image & Video GalleriesRevivePress – Keep your Old Content EvergreenPixel Manager for WooCommerce – Track Google Analytics, Google Ads, TikTok and morePostcode RedirectW3SCloud Contact Form 7 to Zoho CRMShared Files – Frontend File Upload Form & Secure File SharingGrid & Styler For Contact Form 7 And DiviBlock, Suspend, Report for BuddyPressКнопка ЮMoneyChange Price Title for WooCommerceForceFieldHide Shipping Method For WooCommerceWordPress SEO ChecklistEvents Addon for ElementorSend Prebuilt EmailsWP Encryption – One Click Free SSL Certificate & SSL / HTTPS Redirect to Force HTTPS, Security+Appointment & Event Booking Calendar Plugin – Webba BookingDelete Duplicate PostsAlt ManagerJoli FAQ SEO – WordPress FAQ PluginChange Prices with Time for WooCommerceAdvanced Page Visit Counter – Most Wanted Analytics Plugin for WordPressKRSP Frontend File UploaderPay For Post with WooCommerceWooCommerce Bulk Edit Coupons – WP Sheet EditorPosts List Designer by Category – List Category Posts Or Recent PostsLocalSEOMapGFireM Action AfterBookPress – For Book AuthorsAdd Expires Headers & Optimized MinifyCoupon Affiliates – Affiliate Plugin for WooCommerceWP Activity LogDivi Content RestrictorCartoon UrlEvents Calendar RegistrationSecure IP LoginsShare This ImageDashy – Google Analytics advanced dashboardAmelaWordPress Dev Powers – ACF Color Coded Field Types PluginGutenberg Blocks – ACF Blocks SuiteScrollsequence – Cinematic Scroll Image Animation PluginPayment Gateway for PayFabricRankBearAwesome SSLFeatured Products First for WooCommerce – A Extension of WooCommerce (WooCommerce Addon Plugin)South Pole: Climate action nowPremmerce User RolesAdd Twitter Pixel for Twitter adsQuote for WooCommerce Lite – Add to Quote Plugin Lets Customers Request Custom Quotes for Products using the Request a Quote Plugin for WooCommerceAvailability datepicker – Integrate with Contact Form 7 and DiviWooCommerce PayPlugWPBITS Addons For Elementor Page BuilderWP SMS Plugin – WordPress SMS Two Factor Authentication – 2FA, Two Factor, OTP SMS and EmailFullscreen MenuFuse Social Floating SidebarVideopackmyCred – Loyalty Points and Rewards plugin for WordPress and WooCommerce – Give Points, Ranks, Badges, Cashback, WooCommerce rewards, and WooCommerce credits for GamificationBlock Styler For Gravity FormsPremmerce Wholesale Pricing for WooCommerceBook BuyBack PricesProduct Customer List for WooCommerceGift Message for WooCommerceEasy PrayerPremmerce Multi-currency for WoocommerceQuick Paypal PaymentsMigrate WordPress Website & Backups – Prime MoverIks Menu – WordPress Category Accordion Menu & FAQsContact List – Premium Staff Listing, Business Directory Plugin & Address BookWordPress form builder plugin for contact forms, surveys and quizzes – TripettoUltimeterEthereum WalletSurveyFunnel – Survey Plugin for WordPressClickerVolt – Affiliate Links & Click Tracking for Performance MarketersWordPress Translation plugin for Post, Pages & WooCommerce products. Tranzly IO AI DeepL automatic WordPress Translator.azw woocommerce file uploadsDeMomentSomTres AddressWordPress Persistent LoginDrop Shadow BoxesGenerate Images – Magic Post ThumbnailAdFoxly – Ad Manager, AdSense Ads & Ads.txtRemove Add to Cart WooCommerceDynamic Pricing and Discount Rules for WooCommerceRadio Player – Live Shoutcast, Icecast and Any Audio Stream Player for WordPressWCC SEO Keyword ResearchFAQ Manager For Divi, Gutenberg Block & ShortcodeAny Popup – Popup Forms, Optins & AdsWadi SurveySlideDeck: Responsive WordPress Slider PluginDocument Viewer- Plugin to Display MS Office DocsXT Quick View for WooCommercePlace Order Without Payment for WooCommerceBetter SharingTeam Collaboration Plugin for WordPress Editorial teams- MulticollabWP Travel Engine – Tour Booking Plugin – Tour Operator SoftwareBetter Elementor AddonsQuick Event ManagerRun Contests, Raffles, and Giveaways with ContestsWPSKT Templates – 100% free Elementor & Gutenberg templatesDelivery for WooCommerceQuick Contact FormFAQ / Accordion / Docs – Helpie WordPress FAQ Accordion pluginRocket Maintenance Mode & Coming Soon PageEther and ERC20 tokens WooCommerce Payment GatewayWPVisitorInfo – Show Visitor Information & Conditional Data Based On That InformationHM Multiple RolesUltimate Carousel For DiviAFI – The Easiest Integration PluginWP MooseFraud Prevention For WooCommerce and EDDBest Responsive Comparison Table for Gutenberg Editor – NicheTableAdd Tiktok Pixel for Tiktok ads (+Woocommerce)Contact Widgets For Elementor all the contact links you need in one placeProtect Uploads with Login – Protect Your UploadsBulk Edit and Create User Profiles – WP Sheet EditorDa ReactionsMass Pages/Posts CreatorWholesale for WooCommerce — This Wholesale Plugin Helps B2B and B2C Businesses Streamline Wholesale Products, Pricing, and User Roles, Automating their WooCommerce Wholesale StoresQuick Affiliate StoreWordPress Animation Plugin – Animated EverythingWPBakery Page Builder Addons by LivemeshProduct Attachment for WooCommerceAnnouncement & Notification Banner – BulletinAll-in-One Video GallerySocial Gallery LiteRun time Image resizingWUPO Group Attributes for WooCommerceMapGeo – Interactive Geo MapsPinblocks — Gutenberg blocks with Pinterest widgetsDivi Torque Lite – Divi Theme and Extra ThemeSocialMark – Easy Watermark/Logo on Social Media Post Link Share PreviewSQL Reporting Services – SSRS Plugin for WordPressGet Directions MapCaxton – Create Pro page layouts in GutenbergAnt Admin Notices for TeamBetter Messages – WCFM IntegrationZip Code RedirectRedirection for Contact Form 7Custom Login Page CustomizerGet Better Reviews for WooCommerceNew User ApproveTurbo WidgetsMobile View for Responsive web design optimization (UX design) + Mobile Friendly TestThank You Page for WooCommerceBuilder for WooCommerce product reviews shortcodes – ReviewShortkk Star Ratings – Rate Post & Collect User FeedbacksLogo Showcase – Responsive Logo Carousel, Logo Slider & Logo GridRaCar Clear Cart for WooCommerceDeMomentSomTres Media Tools AutoWordPress Google TranslateEasy Tiktok FeedModern Designs for Gravity FormsEasy Math Captcha for CF7Filr – Secure document libraryPreloader for DiviMeridiaWidget Detector for ElementorBrandAutomatic YouTube GalleryRest Routes – Custom Endpoints for WordPress REST APIPurosaYatri ToolsWoowGallery – image gallery / content gallery / ecommerce gallery / social gallery / video gallery / album photo galleryWP Required Taxonomies – Categories and Tags MandatoryWordPress Books GalleryWP Disable SitemapAdd Linkedin insight tags for Linkedin adsProduct Image Watermark for WooFooter Plugin for DiviOverlay Image Divi ModuleDuplicate Variations for WoocommerceWooCommerce Google Analytics Integration By Advanced WC AnalyticsDrip Feed Content Extended for LearndashError Log MonitorBlog Grid & Post Grid – Blog Post Slider, Blog Post Carousel, Blog Post Ticker, Blog Post Masonry, Category Post Grid By News & Blog Designer PackPremmerce Product Search for WooCommerceYASR – Yet Another Star Rating Plugin for WordPressMultisite Robots.txt ManagerInternal Linking for SEO traffic & Ranking – Auto internal links (100% automatic)Woo Admin Product NotesRoyal Elementor Addons and TemplatesSnazzyAdmin WP Admin ThemeSocial KitwGauge – Free VersionElementor Addon ElementsWooCommerce Country Catalogs – Product Country RestrictionsWordPress SEO Audit Plugin – WP Site AuditorWP Tools Divi Product CarouselAds.txt & App-ads.txt Manager for WordPressSimple SponsorshipsKikote – Location Picker at Checkout & Google Address AutoFill Plugin for WooCommerceWP Page TemplatesGuest posting / Frontend Posting wordpress plugin – WP Front User Submit / Front EditorWordPress WooCommerce Sync for Google SheetBooking Calendar | Appointment Booking | BookitFlat Rate Shipping Plugin For WooCommerceGuestofy – Restaurant Reservations Plugin, Room Planer, Reservation FormWP Link BioWordPress Dev Powers – Element Selector jQuery Powers PluginFull Page Blog DesignerTwentyFourth WP ScraperBlock Slider – Responsive Image Slider, Video Slider & Post SliderEnhanced Ecommerce Google Analytics for WooCommerceWidget for Contact form 7Stackable – Page Builder Gutenberg BlocksSimple Feature Requests Free – User Feedback BoardBlockyPage – Gutenberg Based Page BuilderWP AutoMedicGallery PhotoBlocksContact Form 7 – Capsule CRM – IntegrationEvent Tickets and RegistrationEasy Settings for LearnDashWordPress Auto SEO Plugin – Upfiv SEO WizardWP Relevant AdsForms to Zapier, Integromat, IFTTT, Workato, Automate.io, elastic.io, Built.io, APIANT, WebhookUser Menus – Nav Menu VisibilityLittleBot ACH for Stripe + PlaidUnder ConstructionMaster Accordion ( Former WP Awesome FAQ Plugin )XT Points & Rewards for WooCommerceCF7 Constant Contact Fields MappingWP Data Access – WordPress App, Table and Form Builder pluginPassster – Password Protect Pages and ContentOut of stock display for woocommerceClean Social IconsCheckout with Cash App on EDDAutoSave NetSSL Certificate – Free SSL, HTTPS by SSL ZenGateway for PayLate on WooCommerceCourt Reservation – Manage Your Court Bookings OnlineAffiliate Link Builder Plugin for Amazon Associates – Review EngineAdvanced Custom Fields options import/exportRT Easy Builder – Advanced addons for ElementorThe best plugin for restrict content, support all Custom Post Types and Elementor – Password ProtectedChoice Payment Gateway for WooCommerceURL Shortify – Simple, Powerful and Easy URL Shortener Plugin For WordPressWooCommerce Shipping gateway per ProductWP Tools Divi Blog CarouselSimple Social Page Widget & ShortcodeUltimate Bulk SEO Noindex Nofollow – Speed up Penalty Recovery Ultimate SEO BoosterEducation Addon for ElementorAdvanced Classifieds & Directory ProCode ManagerHuCommerce | Magyar WooCommerce kiegészítésekFree Booking Plugin for Hotels, Restaurants and Car Rentals – eaSYNC BookingFeedpress Generator – External RSS Frontend CustomizerSTAX Header BuilderWP Google Street View (with 360° virtual tour) & Google maps + Local SEOUltimate Divi Modules Suite – Divi Sumo LiteWordPress Buffer – HYPESocial. Social Media Auto Post, Social Media Auto Publish and ScheduleFIT: Featured Image ToolkitConversion de moneda WoocommerceWP Adminify – Custom WordPress Dashboard, Login and Admin CustomizerGo Viral – social share, social sharebar, social locker, social chat, open graph, reactions, share & view countersWooCommerce Bulk Edit Products – WP Sheet EditorWP SierraWordPress Gallery Plugin – Edge Photo GalleryPootle Pagebuilder – WordPress Page builderTickera – WordPress Event Ticketing
CWE ID-CWE-862
Missing Authorization
CVE-2023-41866
Matching Score-6
Assigner-Patchstack
ShareView Details
Matching Score-6
Assigner-Patchstack
CVSS Score-4.3||MEDIUM
EPSS-0.20% / 42.24%
||
7 Day CHG~0.00%
Published-13 Dec, 2024 | 14:24
Updated-16 Dec, 2024 | 17:57
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Automatic YouTube Gallery plugin <= 2.3.3 - Broken Access Control vulnerability

Missing Authorization vulnerability in Team Plugins360 Automatic YouTube Gallery allows Exploiting Incorrectly Configured Access Control Security Levels.This issue affects Automatic YouTube Gallery: from n/a through 2.3.3.

Action-Not Available
Vendor-Team Plugins360
Product-Automatic YouTube Gallery
CWE ID-CWE-862
Missing Authorization
CVE-2025-8418
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-0.21% / 42.81%
||
7 Day CHG~0.00%
Published-12 Aug, 2025 | 06:42
Updated-12 Aug, 2025 | 16:05
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
B Slider- Gutenberg Slider Block for WP <= 1.1.30 - Authenticated (Subscriber+) Missing Authorization to Arbitrary Plugin Installation

The B Slider- Gutenberg Slider Block for WP plugin for WordPress is vulnerable to Arbitrary Plugin Installation in all versions up to, and including, 1.1.30. This is due to missing capability checks on the activated_plugin function. This makes it possible for authenticated attackers, with subscriber-level access and above, to install arbitrary plugins on the server which can make remote code execution possible.

Action-Not Available
Vendor-bplugins
Product-B Slider- Gutenberg Slider Block for WP
CWE ID-CWE-862
Missing Authorization
CVE-2025-8322
Matching Score-4
Assigner-TWCERT/CC
ShareView Details
Matching Score-4
Assigner-TWCERT/CC
CVSS Score-8.7||HIGH
EPSS-0.11% / 30.90%
||
7 Day CHG~0.00%
Published-30 Jul, 2025 | 02:49
Updated-31 Jul, 2025 | 18:42
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Ventem|e-School - Missing Authorization

The e-School from Ventem has a Missing Authorization vulnerability, allowing remote attackers with regular privilege to access administrator functions, including creating, modifying, and deleting accounts. They can even escalate any account to system administrator privilege.

Action-Not Available
Vendor-Ventem
Product-e-School
CWE ID-CWE-862
Missing Authorization
CVE-2020-2302
Matching Score-4
Assigner-Jenkins Project
ShareView Details
Matching Score-4
Assigner-Jenkins Project
CVSS Score-4.3||MEDIUM
EPSS-0.03% / 7.05%
||
7 Day CHG~0.00%
Published-04 Nov, 2020 | 14:35
Updated-04 Aug, 2024 | 07:09
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

A missing permission check in Jenkins Active Directory Plugin 2.19 and earlier allows attackers with Overall/Read permission to access the domain health check diagnostic page.

Action-Not Available
Vendor-Jenkins
Product-active_directoryJenkins Active Directory Plugin
CWE ID-CWE-862
Missing Authorization
CVE-2020-11679
Matching Score-4
Assigner-MITRE Corporation
ShareView Details
Matching Score-4
Assigner-MITRE Corporation
CVSS Score-8.8||HIGH
EPSS-0.14% / 35.11%
||
7 Day CHG~0.00%
Published-04 Jun, 2020 | 18:31
Updated-04 Aug, 2024 | 11:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

Castel NextGen DVR v1.0.0 is vulnerable to privilege escalation through the Adminstrator/Users/Edit/:UserId functionality. Adminstrator/Users/Edit/:UserId fails to check that the request was submitted by an Administrator. This allows a normal user to escalate their privileges by adding additional roles to their account.

Action-Not Available
Vendor-casteln/a
Product-nextgen_dvr_firmwarenextgen_dvrn/a
CWE ID-CWE-862
Missing Authorization
CVE-2024-28155
Matching Score-4
Assigner-Jenkins Project
ShareView Details
Matching Score-4
Assigner-Jenkins Project
CVSS Score-4.3||MEDIUM
EPSS-0.05% / 15.70%
||
7 Day CHG~0.00%
Published-06 Mar, 2024 | 17:01
Updated-29 Mar, 2025 | 00:15
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

Jenkins AppSpider Plugin 1.0.16 and earlier does not perform permission checks in several HTTP endpoints, allowing attackers with Overall/Read permission to obtain information about available scan config names, engine group names, and client names.

Action-Not Available
Vendor-Jenkins
Product-appspiderJenkins AppSpider Plugin
CWE ID-CWE-862
Missing Authorization
CVE-2022-45390
Matching Score-4
Assigner-Jenkins Project
ShareView Details
Matching Score-4
Assigner-Jenkins Project
CVSS Score-4.3||MEDIUM
EPSS-0.09% / 26.37%
||
7 Day CHG~0.00%
Published-15 Nov, 2022 | 00:00
Updated-30 Apr, 2025 | 18:15
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

A missing permission check in Jenkins loader.io Plugin 1.0.1 and earlier allows attackers with Overall/Read permission to enumerate credentials IDs of credentials stored in Jenkins.

Action-Not Available
Vendor-Jenkins
Product-loader.ioJenkins loader.io Plugin
CWE ID-CWE-862
Missing Authorization
CVE-2025-6993
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-7.5||HIGH
EPSS-0.05% / 16.41%
||
7 Day CHG~0.00%
Published-16 Jul, 2025 | 09:22
Updated-02 Aug, 2025 | 01:29
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Ultimate WP Mail 1.0.17 - 1.3.6 - Missing Authorization to Authenticated (Contributor+) Privilege Escalation via get_email_log_details Function

The Ultimate WP Mail plugin for WordPress is vulnerable to Privilege Escalation due to improper authorization within the get_email_log_details() AJAX handler in versions 1.0.17 to 1.3.6. The handler reads the client-supplied post_id and retrieves the corresponding email log post content (including the password-reset link), relying only on the ‘edit_posts’ capability without restricting to administrators or validating ownership. This makes it possible for authenticated attackers, with Contributor-level access and above, to harvest an admin’s reset link and elevate their privileges to administrator.

Action-Not Available
Vendor-rustauriusrustaurius
Product-ultimate_wp_mailUltimate WP Mail
CWE ID-CWE-862
Missing Authorization
CVE-2025-7695
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-0.05% / 16.80%
||
7 Day CHG+0.01%
Published-24 Jul, 2025 | 09:22
Updated-25 Jul, 2025 | 15:29
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Dataverse Integration 2.77 - 2.81 - Missing Authorization to Authenticated (Subscriber+) Privilege Escalation via reset_password_link REST Route

The Dataverse Integration plugin for WordPress is vulnerable to Privilege Escalation due to missing authorization checks within its reset_password_link REST endpoint in versions 2.77 through 2.81. The endpoint’s handler accepts a client-supplied id, email, or login, looks up that user, and calls get_password_reset_key() unconditionally. Because it only checks that the caller is authenticated, and not that they own or may edit the target account, any authenticated attacker, with Subscriber-level access and above, can obtain a password reset link for an administrator and hijack that account.

Action-Not Available
Vendor-alexacrm
Product-Dataverse Integration
CWE ID-CWE-862
Missing Authorization
CVE-2025-6754
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-0.06% / 17.29%
||
7 Day CHG~0.00%
Published-02 Aug, 2025 | 07:24
Updated-04 Aug, 2025 | 15:06
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
SEO Metrics <= 1.0.5 - Missing Authorization to Authenticated (Subscriber+) Privilege Escalation

The SEO Metrics plugin for WordPress is vulnerable to Privilege Escalation due to missing authorization checks in both the seo_metrics_handle_connect_button_click() AJAX handler and the seo_metrics_handle_custom_endpoint() function in versions 1.0.5 through 1.0.15. Because the AJAX action only verifies a nonce, without checking the caller’s capabilities, a subscriber-level user can retrieve the token and then access the custom endpoint to obtain full administrator cookies.

Action-Not Available
Vendor-seometricsplugin
Product-SEO Metrics
CWE ID-CWE-862
Missing Authorization
CVE-2020-12698
Matching Score-4
Assigner-MITRE Corporation
ShareView Details
Matching Score-4
Assigner-MITRE Corporation
CVSS Score-4.3||MEDIUM
EPSS-0.13% / 33.16%
||
7 Day CHG~0.00%
Published-13 May, 2020 | 12:41
Updated-04 Aug, 2024 | 12:04
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

The direct_mail extension through 5.2.3 for TYPO3 has Broken Access Control for newsletter subscriber tables.

Action-Not Available
Vendor-dkdn/a
Product-direct_mailn/a
CWE ID-CWE-862
Missing Authorization
CVE-2020-12700
Matching Score-4
Assigner-MITRE Corporation
ShareView Details
Matching Score-4
Assigner-MITRE Corporation
CVSS Score-4.3||MEDIUM
EPSS-0.13% / 33.16%
||
7 Day CHG~0.00%
Published-13 May, 2020 | 12:43
Updated-04 Aug, 2024 | 12:04
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

The direct_mail extension through 5.2.3 for TYPO3 allows Information Disclosure via a newsletter subscriber data Special Query.

Action-Not Available
Vendor-dkdn/a
Product-direct_mailn/a
CWE ID-CWE-862
Missing Authorization
CVE-2024-43332
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-4.3||MEDIUM
EPSS-0.32% / 54.05%
||
7 Day CHG+0.05%
Published-01 Nov, 2024 | 14:17
Updated-13 Nov, 2024 | 01:25
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Photo Engine plugin <= 6.4.0 - Broken Access Control vulnerability

Missing Authorization vulnerability in Jordy Meow Photo Engine allows Exploiting Incorrectly Configured Access Control Security Levels.This issue affects Photo Engine: from n/a through 6.4.0.

Action-Not Available
Vendor-meowappsJordy Meow
Product-photo_enginePhoto Engine
CWE ID-CWE-862
Missing Authorization
CVE-2020-12138
Matching Score-4
Assigner-MITRE Corporation
ShareView Details
Matching Score-4
Assigner-MITRE Corporation
CVSS Score-8.8||HIGH
EPSS-0.67% / 70.39%
||
7 Day CHG~0.00%
Published-27 Apr, 2020 | 14:31
Updated-04 Aug, 2024 | 11:48
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

AMD ATI atillk64.sys 5.11.9.0 allows low-privileged users to interact directly with physical memory by calling one of several driver routines that map physical memory into the virtual address space of the calling process. This could enable low-privileged users to achieve NT AUTHORITY\SYSTEM privileges via a DeviceIoControl call associated with MmMapIoSpace, IoAllocateMdl, MmBuildMdlForNonPagedPool, or MmMapLockedPages.

Action-Not Available
Vendor-n/aAdvanced Micro Devices, Inc.
Product-atillk64n/a
CWE ID-CWE-862
Missing Authorization
CVE-2020-13794
Matching Score-4
Assigner-MITRE Corporation
ShareView Details
Matching Score-4
Assigner-MITRE Corporation
CVSS Score-4.3||MEDIUM
EPSS-0.21% / 42.74%
||
7 Day CHG~0.00%
Published-29 Sep, 2020 | 20:17
Updated-04 Aug, 2024 | 12:25
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

Harbor 1.9.* 1.10.* and 2.0.* allows Exposure of Sensitive Information to an Unauthorized Actor.

Action-Not Available
Vendor-n/aThe Linux Foundation
Product-harborn/a
CWE ID-CWE-862
Missing Authorization
CVE-2024-24741
Matching Score-4
Assigner-SAP SE
ShareView Details
Matching Score-4
Assigner-SAP SE
CVSS Score-4.3||MEDIUM
EPSS-0.15% / 36.64%
||
7 Day CHG~0.00%
Published-13 Feb, 2024 | 03:43
Updated-16 Oct, 2024 | 21:16
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Missing Authorization check in SAP Master Data Governance Material

SAP Master Data Governance for Material Data - versions 618, 619, 620, 621, 622, 800, 801, 802, 803, 804, does not perform necessary authorization check for an authenticated user, resulting in escalation of privileges. This could allow an attacker to read some sensitive information but no impact to integrity and availability.

Action-Not Available
Vendor-SAP SE
Product-master_data_governance_for_material_dataSAP Master Data Governance Material
CWE ID-CWE-862
Missing Authorization
CVE-2024-24840
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-4.3||MEDIUM
EPSS-0.08% / 23.61%
||
7 Day CHG~0.00%
Published-23 Mar, 2024 | 14:45
Updated-29 Jan, 2025 | 15:33
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Element Pack Elementor Addons plugin <= 5.4.11 - Broken Access Control on Duplicate Post vulnerability

Missing Authorization vulnerability in BdThemes Element Pack Elementor Addons.This issue affects Element Pack Elementor Addons: from n/a through 5.4.11.

Action-Not Available
Vendor-BdThemesBdThemes
Product-element_packElement Pack Elementor Addons
CWE ID-CWE-862
Missing Authorization
CVE-2024-25092
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-8.8||HIGH
EPSS-65.01% / 98.40%
||
7 Day CHG~0.00%
Published-09 Jun, 2024 | 10:28
Updated-11 Oct, 2024 | 14:01
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress NextMove Lite plugin <= 2.17.0 - Subscriber+ Arbitrary Plugin Installation/Activation vulnerability

Missing Authorization vulnerability in XLPlugins NextMove Lite.This issue affects NextMove Lite: from n/a through 2.17.0.

Action-Not Available
Vendor-xlpluginsXLPluginsxlplugins
Product-nextmoveNextMove Litenextmove_lite
CWE ID-CWE-862
Missing Authorization
CVE-2024-24833
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-4.3||MEDIUM
EPSS-0.35% / 56.53%
||
7 Day CHG~0.00%
Published-08 May, 2024 | 13:28
Updated-08 Jan, 2025 | 17:14
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Happy Addons for Elementor plugin <= 3.10.1 - Broken Access Control on Post Clone vulnerability

Missing Authorization vulnerability in Leevio Happy Addons for Elementor.This issue affects Happy Addons for Elementor: from n/a through 3.10.1.

Action-Not Available
Vendor-leevioLeevio
Product-happy_addons_for_elementorHappy Addons for Elementor
CWE ID-CWE-862
Missing Authorization
CVE-2024-24883
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-4.3||MEDIUM
EPSS-0.22% / 44.55%
||
7 Day CHG~0.00%
Published-21 Mar, 2024 | 17:55
Updated-07 Feb, 2025 | 01:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Prime Slider plugin <= 3.11.10 - Broken Access Control on Duplicate Post vulnerability

Missing Authorization vulnerability in BdThemes Prime Slider – Addons For Elementor.This issue affects Prime Slider – Addons For Elementor: from n/a through 3.11.10.

Action-Not Available
Vendor-BdThemesBdThemes
Product-prime_sliderPrime Slider – Addons For Elementorprime_slider
CWE ID-CWE-862
Missing Authorization
CVE-2020-11465
Matching Score-4
Assigner-MITRE Corporation
ShareView Details
Matching Score-4
Assigner-MITRE Corporation
CVSS Score-8.8||HIGH
EPSS-0.53% / 66.32%
||
7 Day CHG~0.00%
Published-01 Apr, 2020 | 20:51
Updated-04 Aug, 2024 | 11:28
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

An issue was discovered in Deskpro before 2019.8.0. The /api/apps/* endpoints failed to properly validate a user's privilege, allowing an attacker to control/install helpdesk applications and leak current applications' configurations, including applications used as user sources (used for authentication). This enables an attacker to forge valid authentication models that resembles any user on the system.

Action-Not Available
Vendor-deskpron/a
Product-deskpron/a
CWE ID-CWE-862
Missing Authorization
CVE-2024-23493
Matching Score-4
Assigner-Mattermost, Inc.
ShareView Details
Matching Score-4
Assigner-Mattermost, Inc.
CVSS Score-4.3||MEDIUM
EPSS-0.16% / 37.13%
||
7 Day CHG~0.00%
Published-29 Feb, 2024 | 08:02
Updated-10 Jan, 2025 | 15:34
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Team associated AD/LDAP Groups Leaked due to missing authorization

Mattermost fails to properly authorize the requests fetching team associated AD/LDAP groups, allowing a user to fetch details of AD/LDAP groups of a team that they are not a member of. 

Action-Not Available
Vendor-Mattermost, Inc.
Product-mattermost_serverMattermost
CWE ID-CWE-200
Exposure of Sensitive Information to an Unauthorized Actor
CWE ID-CWE-862
Missing Authorization
CVE-2024-23524
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-5.3||MEDIUM
EPSS-0.23% / 45.85%
||
7 Day CHG~0.00%
Published-10 Jun, 2024 | 08:03
Updated-25 Sep, 2024 | 14:48
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress PilotPress plugin <= 2.0.30 - Broken Access Control vulnerability

Missing Authorization vulnerability in ONTRAPORT Inc. PilotPress.This issue affects PilotPress: from n/a through 2.0.30.

Action-Not Available
Vendor-ontraportONTRAPORT Inc.
Product-pilotpressPilotPress
CWE ID-CWE-862
Missing Authorization
CVE-2025-7689
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-0.04% / 11.44%
||
7 Day CHG~0.00%
Published-29 Jul, 2025 | 09:23
Updated-29 Jul, 2025 | 14:14
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Hydra Booking 1.1.0 - 1.1.18 - Missing Authorization to Authenticated (Subscriber+) Privilege Escalation via tfhb_reset_password_callback Function

The Hydra Booking plugin for WordPress is vulnerable to Privilege Escalation due to a missing capability check on the tfhb_reset_password_callback() function in versions 1.1.0 to 1.1.18. This makes it possible for authenticated attackers, with Subscriber-level access and above, to reset the password of an Administrator user, achieving full privilege escalation.

Action-Not Available
Vendor-themefic
Product-Hydra Booking – All in One Appointment Booking System | Appointment Scheduling, Booking Calendar & WooCommerce Bookings
CWE ID-CWE-862
Missing Authorization
CVE-2024-23503
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-4.3||MEDIUM
EPSS-0.07% / 21.11%
||
7 Day CHG~0.00%
Published-11 Jun, 2024 | 16:09
Updated-07 Aug, 2024 | 14:27
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Ninja Tables plugin <= 5.0.6 - Broken Access Control vulnerability

Missing Authorization vulnerability in WPManageNinja LLC Ninja Tables.This issue affects Ninja Tables: from n/a through 5.0.6.

Action-Not Available
Vendor-wpmanageninjaWPManageNinja LLC
Product-ninja_tablesNinja Tables
CWE ID-CWE-862
Missing Authorization
CVE-2025-6718
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-0.03% / 8.53%
||
7 Day CHG~0.00%
Published-18 Jul, 2025 | 05:23
Updated-22 Jul, 2025 | 13:06
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
B1.lt for WooCommerce <= 2.2.56 - Missing Authorization to Authenticated (Subscriber+) Arbitrary SQL Injection

The B1.lt plugin for WordPress is vulnerable to SQL Injection due to a missing capability check on the b1_run_query AJAX action in all versions up to, and including, 2.2.56. This makes it possible for authenticated attackers, with Subscriber-level access and above, to execute and run arbitrary SQL commands.

Action-Not Available
Vendor-b1accounting
Product-B1.lt
CWE ID-CWE-862
Missing Authorization
CVE-2025-6813
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-0.05% / 14.06%
||
7 Day CHG~0.00%
Published-18 Jul, 2025 | 04:23
Updated-22 Jul, 2025 | 13:06
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
aapanel WP Toolkit 1.0 - 1.1 - Missing Authorization to Authenticated (Subscriber+) Privilege Escalation via auto_login() Function

The aapanel WP Toolkit plugin for WordPress is vulnerable to Privilege Escalation due to missing authorization checks within the auto_login() function in versions 1.0 to 1.1. This makes it possible for authenticated attackers, with Subscriber-level access and above, to bypass all role checks and gain full admin privileges.

Action-Not Available
Vendor-aapanel
Product-aapanel WP Toolkit
CWE ID-CWE-862
Missing Authorization
CVE-2022-45356
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-5.4||MEDIUM
EPSS-0.09% / 25.63%
||
7 Day CHG~0.00%
Published-25 Mar, 2024 | 11:23
Updated-31 Jan, 2025 | 14:23
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Betheme premium theme <= 26.6.1 - Broken Access Control vulnerability

Missing Authorization vulnerability in Muffingroup Betheme.This issue affects Betheme: from n/a through 26.6.1.

Action-Not Available
Vendor-Muffin Group
Product-bethemeBetheme
CWE ID-CWE-862
Missing Authorization
CVE-2022-43417
Matching Score-4
Assigner-Jenkins Project
ShareView Details
Matching Score-4
Assigner-Jenkins Project
CVSS Score-4.3||MEDIUM
EPSS-0.13% / 33.25%
||
7 Day CHG~0.00%
Published-19 Oct, 2022 | 00:00
Updated-08 May, 2025 | 19:15
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

Jenkins Katalon Plugin 1.0.32 and earlier does not perform permission checks in several HTTP endpoints, allowing attackers with Overall/Read permission to connect to an attacker-specified URL using attacker-specified credentials IDs obtained through another method, capturing credentials stored in Jenkins.

Action-Not Available
Vendor-Jenkins
Product-katalonJenkins Katalon Plugin
CWE ID-CWE-862
Missing Authorization
CVE-2022-43685
Matching Score-4
Assigner-MITRE Corporation
ShareView Details
Matching Score-4
Assigner-MITRE Corporation
CVSS Score-8.8||HIGH
EPSS-0.27% / 49.92%
||
7 Day CHG~0.00%
Published-22 Nov, 2022 | 00:00
Updated-29 Apr, 2025 | 05:15
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

CKAN through 2.9.6 account takeovers by unauthenticated users when an existing user id is sent via an HTTP POST request. This allows a user to take over an existing account including superuser accounts.

Action-Not Available
Vendor-okfnn/a
Product-ckann/a
CWE ID-CWE-862
Missing Authorization
CVE-2022-42884
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-5.4||MEDIUM
EPSS-0.09% / 25.63%
||
7 Day CHG~0.00%
Published-17 Jan, 2024 | 18:17
Updated-23 May, 2025 | 16:01
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress WIP Custom Login Plugin <= 1.2.7 is vulnerable to Broken Access Control

Missing Authorization vulnerability in ThemeinProgress WIP Custom Login.This issue affects WIP Custom Login: from n/a through 1.2.7.

Action-Not Available
Vendor-themeinprogressThemeinProgress
Product-wip_custom_loginWIP Custom Login
CWE ID-CWE-862
Missing Authorization
CVE-2022-43453
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-8.8||HIGH
EPSS-0.39% / 59.48%
||
7 Day CHG~0.00%
Published-21 Jun, 2024 | 13:33
Updated-03 Aug, 2024 | 13:32
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress WP Tools plugin <= 3.41 - Auth. Broken Access Control vulnerability

Missing Authorization vulnerability in Bill Minozzi WP Tools.This issue affects WP Tools: from n/a through 3.41.

Action-Not Available
Vendor-billminozziBill Minozzibillminozzi
Product-wp_toolsWP Toolswp_tools
CWE ID-CWE-862
Missing Authorization
CVE-2022-43472
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-4.3||MEDIUM
EPSS-0.11% / 29.53%
||
7 Day CHG~0.00%
Published-13 Dec, 2024 | 14:21
Updated-23 Dec, 2024 | 18:07
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress eRoom plugin <= 1.4.6 - Broken Access Control vulnerability

Missing Authorization vulnerability in StylemixThemes eRoom – Zoom Meetings & Webinar allows Exploiting Incorrectly Configured Access Control Security Levels.This issue affects eRoom – Zoom Meetings & Webinar: from n/a through 1.4.6.

Action-Not Available
Vendor-StylemixThemes
Product-eRoom – Zoom Meetings & Webinar
CWE ID-CWE-862
Missing Authorization
CVE-2022-43476
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-4.3||MEDIUM
EPSS-0.11% / 29.53%
||
7 Day CHG~0.00%
Published-02 Jan, 2025 | 14:23
Updated-02 Jan, 2025 | 15:15
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Subscribe to Category Plugin <= 2.7.4 is vulnerable to Broken Access Control

Missing Authorization vulnerability in Daniel Söderström / Sidney van de Stouwe Subscribe to Category allows Exploiting Incorrectly Configured Access Control Security Levels.This issue affects Subscribe to Category: from n/a through 2.7.4.

Action-Not Available
Vendor-Daniel Söderström / Sidney van de Stouwe
Product-Subscribe to Category
CWE ID-CWE-862
Missing Authorization
CVE-2022-43431
Matching Score-4
Assigner-Jenkins Project
ShareView Details
Matching Score-4
Assigner-Jenkins Project
CVSS Score-4.3||MEDIUM
EPSS-0.14% / 35.27%
||
7 Day CHG~0.00%
Published-19 Oct, 2022 | 00:00
Updated-08 May, 2025 | 19:15
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

Jenkins Compuware Strobe Measurement Plugin 1.0.1 and earlier does not perform a permission check in an HTTP endpoint, allowing attackers with Overall/Read permission to enumerate credentials IDs of credentials stored in Jenkins.

Action-Not Available
Vendor-Jenkins
Product-compuware_strobe_measurementJenkins Compuware Strobe Measurement Plugin
CWE ID-CWE-862
Missing Authorization
CVE-2025-5953
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-0.06% / 17.39%
||
7 Day CHG~0.00%
Published-04 Jul, 2025 | 01:44
Updated-13 Aug, 2025 | 19:29
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WP Human Resource Management 2.0.0 - 2.2.17 - Missing Authorization to Authenticated (Employee+) Privilege Escalation via wp_ajax_hrm_insert_employee AJAX Action

The WP Human Resource Management plugin for WordPress is vulnerable to Privilege Escalation due to missing authorization in the ajax_insert_employee() and update_empoyee() functions in versions 2.0.0 through 2.2.17. The AJAX handler reads the client-supplied $_POST['role'] and, after basic cleaning via hrm_clean(), passes it directly to wp_insert_user() and later to $user->set_role() without verifying that the current user is allowed to assign that role. This makes it possible for authenticated attackers, with Employee-level access and above, to elevate their privileges to administrator.

Action-Not Available
Vendor-mishubdasaquzzaman
Product-wp_human_resource_managementWP Human Resource Management
CWE ID-CWE-862
Missing Authorization
CVE-2022-41692
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-4.3||MEDIUM
EPSS-0.15% / 35.99%
||
7 Day CHG~0.00%
Published-18 Nov, 2022 | 18:54
Updated-20 Feb, 2025 | 19:52
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Appointment Hour Booking plugin <= 1.3.71 - Missing Authorization vulnerability

Missing Authorization vulnerability in Appointment Hour Booking plugin <= 1.3.71 on WordPress.

Action-Not Available
Vendor-CodePeople
Product-appointment_hour_bookingAppointment Hour Booking (WordPress plugin)
CWE ID-CWE-862
Missing Authorization
CVE-2022-41252
Matching Score-4
Assigner-Jenkins Project
ShareView Details
Matching Score-4
Assigner-Jenkins Project
CVSS Score-4.3||MEDIUM
EPSS-0.43% / 61.97%
||
7 Day CHG~0.00%
Published-21 Sep, 2022 | 15:46
Updated-28 May, 2025 | 15:15
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

Missing permission checks in Jenkins CONS3RT Plugin 1.0.0 and earlier allows users with Overall/Read permission to enumerate credentials ID of credentials stored in Jenkins.

Action-Not Available
Vendor-Jenkins
Product-cons3rtJenkins CONS3RT Plugin
CWE ID-CWE-862
Missing Authorization
CVE-2022-41251
Matching Score-4
Assigner-Jenkins Project
ShareView Details
Matching Score-4
Assigner-Jenkins Project
CVSS Score-4.3||MEDIUM
EPSS-0.43% / 61.97%
||
7 Day CHG~0.00%
Published-21 Sep, 2022 | 15:46
Updated-28 May, 2025 | 15:15
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

A missing permission check in Jenkins Apprenda Plugin 2.2.0 and earlier allows users with Overall/Read permission to enumerate credentials IDs of credentials stored in Jenkins.

Action-Not Available
Vendor-Jenkins
Product-apprendaJenkins Apprenda Plugin
CWE ID-CWE-862
Missing Authorization
CVE-2024-43118
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-4.3||MEDIUM
EPSS-0.32% / 54.05%
||
7 Day CHG+0.05%
Published-01 Nov, 2024 | 14:17
Updated-15 May, 2025 | 17:25
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Hummingbird plugin <= 3.9.1 - Broken Access Control vulnerability

Missing Authorization vulnerability in WPMU DEV Hummingbird allows Exploiting Incorrectly Configured Access Control Security Levels.This issue affects Hummingbird: from n/a through 3.9.1.

Action-Not Available
Vendor-Incsub, LLC
Product-hummingbirdHummingbird
CWE ID-CWE-862
Missing Authorization
CVE-2022-41233
Matching Score-4
Assigner-Jenkins Project
ShareView Details
Matching Score-4
Assigner-Jenkins Project
CVSS Score-4.3||MEDIUM
EPSS-0.43% / 61.97%
||
7 Day CHG~0.00%
Published-21 Sep, 2022 | 15:45
Updated-28 May, 2025 | 15:15
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

Jenkins Rundeck Plugin 3.6.11 and earlier does not perform Run/Artifacts permission checks in multiple HTTP endpoints, allowing attackers with Item/Read permission to obtain information about build artifacts of a given job, if the optional Run/Artifacts permission is enabled.

Action-Not Available
Vendor-Jenkins
Product-rundeckJenkins Rundeck Plugin
CWE ID-CWE-862
Missing Authorization
CVE-2022-3911
Matching Score-4
Assigner-WPScan
ShareView Details
Matching Score-4
Assigner-WPScan
CVSS Score-8.8||HIGH
EPSS-0.13% / 33.79%
||
7 Day CHG~0.00%
Published-02 Jan, 2023 | 21:49
Updated-10 Apr, 2025 | 19:15
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
iubenda < 3.3.3 - Subscriber+ Privileges Escalation to Admin

The iubenda WordPress plugin before 3.3.3 does does not have authorisation and CSRF in an AJAX action, and does not ensure that the options to be updated belong to the plugin as long as they are arrays. As a result, any authenticated users, such as subscriber can grant themselves any privileges, such as edit_plugins etc

Action-Not Available
Vendor-iubendaUnknown
Product-iubenda-cookie-law-solutioniubenda | All-in-one Compliance for GDPR / CCPA Cookie Consent + more
CWE ID-CWE-352
Cross-Site Request Forgery (CSRF)
CWE ID-CWE-862
Missing Authorization
CVE-2022-41230
Matching Score-4
Assigner-Jenkins Project
ShareView Details
Matching Score-4
Assigner-Jenkins Project
CVSS Score-4.3||MEDIUM
EPSS-0.43% / 61.97%
||
7 Day CHG~0.00%
Published-21 Sep, 2022 | 15:45
Updated-28 May, 2025 | 15:15
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

Jenkins Build-Publisher Plugin 1.22 and earlier does not perform a permission check in an HTTP endpoint, allowing attackers with Overall/Read permission to obtain names and URLs of Jenkins servers that the plugin is configured to publish builds to, as well as builds pending for publication to those Jenkins servers.

Action-Not Available
Vendor-Jenkins
Product-build-publisherJenkins Build-Publisher Plugin
CWE ID-CWE-862
Missing Authorization
CVE-2022-36898
Matching Score-4
Assigner-Jenkins Project
ShareView Details
Matching Score-4
Assigner-Jenkins Project
CVSS Score-4.3||MEDIUM
EPSS-0.34% / 55.85%
||
7 Day CHG~0.00%
Published-27 Jul, 2022 | 14:24
Updated-03 Aug, 2024 | 10:14
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

A missing permission check in Jenkins Compuware ISPW Operations Plugin 1.0.8 and earlier allows attackers with Overall/Read permission to enumerate hosts and ports of Compuware configurations and credentials IDs of credentials stored in Jenkins.

Action-Not Available
Vendor-Jenkins
Product-compuware_ispw_operationsJenkins Compuware ISPW Operations Plugin
CWE ID-CWE-862
Missing Authorization
CVE-2022-36919
Matching Score-4
Assigner-Jenkins Project
ShareView Details
Matching Score-4
Assigner-Jenkins Project
CVSS Score-4.3||MEDIUM
EPSS-0.40% / 59.60%
||
7 Day CHG~0.00%
Published-27 Jul, 2022 | 14:28
Updated-03 Aug, 2024 | 10:14
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

A missing permission check in Jenkins Coverity Plugin 1.11.4 and earlier allows attackers with Overall/Read permission to enumerate credentials IDs of credentials stored in Jenkins.

Action-Not Available
Vendor-Jenkins
Product-coverityJenkins Coverity Plugin
CWE ID-CWE-862
Missing Authorization
CVE-2022-36918
Matching Score-4
Assigner-Jenkins Project
ShareView Details
Matching Score-4
Assigner-Jenkins Project
CVSS Score-4.3||MEDIUM
EPSS-0.07% / 22.39%
||
7 Day CHG~0.00%
Published-27 Jul, 2022 | 14:28
Updated-03 Aug, 2024 | 10:14
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

Jenkins Buckminster Plugin 1.1.1 and earlier does not perform a permission check in a method implementing form validation, allowing attackers with Overall/Read permission to check for the existence of an attacker-specified file path on the Jenkins controller file system.

Action-Not Available
Vendor-Jenkins
Product-buckminsterJenkins Buckminster Plugin
CWE ID-CWE-862
Missing Authorization
CVE-2022-36914
Matching Score-4
Assigner-Jenkins Project
ShareView Details
Matching Score-4
Assigner-Jenkins Project
CVSS Score-4.3||MEDIUM
EPSS-0.09% / 26.99%
||
7 Day CHG~0.00%
Published-27 Jul, 2022 | 14:27
Updated-03 Aug, 2024 | 10:14
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

Jenkins Files Found Trigger Plugin 1.5 and earlier does not perform a permission check in a method implementing form validation, allowing attackers with Overall/Read permission to check for the existence of an attacker-specified file path on the Jenkins controller file system.

Action-Not Available
Vendor-Jenkins
Product-files_found_triggerJenkins Files Found Trigger Plugin
CWE ID-CWE-862
Missing Authorization
  • Previous
  • 1
  • 2
  • 3
  • ...
  • 14
  • 15
  • Next
Details not found