Logo
-

Byte Open Security

(ByteOS Network)

Log In

Sign Up

ByteOS

Security
Vulnerability Details
Registries
Custom Views
Weaknesses
Attack Patterns
Filters & Tools
Vulnerability Details :

CVE-2024-1710

Summary
Assigner-Wordfence
Assigner Org ID-b15e7b5b-3da4-40ae-a43c-f7aa60e62599
Published At-24 Feb, 2024 | 09:38
Updated At-08 Apr, 2026 | 16:37
Rejected At-
Credits

Addon Library <= 1.3.76 - Missing Authorization to Authenticated (Subscriber+) Arbitrary File Upload

The Addon Library plugin for WordPress is vulnerable to unauthorized access of data due to a missing capability check on the onAjaxAction function action in all versions up to, and including, 1.3.76. This makes it possible for authenticated attackers, with subscriber-level access and above, to perform several unauthorized actions including uploading arbitrary files.

Vendors
-
Not available
Products
-
Metrics (CVSS)
VersionBase scoreBase severityVector
Weaknesses
Attack Patterns
Solution/Workaround
References
HyperlinkResource Type
EPSS History
Score
Latest Score
-
N/A
No data available for selected date range
Percentile
Latest Percentile
-
N/A
No data available for selected date range
Stakeholder-Specific Vulnerability Categorization (SSVC)
▼Common Vulnerabilities and Exposures (CVE)
cve.org
Assigner:Wordfence
Assigner Org ID:b15e7b5b-3da4-40ae-a43c-f7aa60e62599
Published At:24 Feb, 2024 | 09:38
Updated At:08 Apr, 2026 | 16:37
Rejected At:
▼CVE Numbering Authority (CNA)
Addon Library <= 1.3.76 - Missing Authorization to Authenticated (Subscriber+) Arbitrary File Upload

The Addon Library plugin for WordPress is vulnerable to unauthorized access of data due to a missing capability check on the onAjaxAction function action in all versions up to, and including, 1.3.76. This makes it possible for authenticated attackers, with subscriber-level access and above, to perform several unauthorized actions including uploading arbitrary files.

Affected Products
Vendor
unitecms
Product
Addon Library
Default Status
unaffected
Versions
Affected
  • From 0 through 1.3.76 (semver)
Problem Types
TypeCWE IDDescription
CWECWE-862CWE-862 Missing Authorization
Type: CWE
CWE ID: CWE-862
Description: CWE-862 Missing Authorization
Metrics
VersionBase scoreBase severityVector
3.18.8HIGH
CVSS:3.1/AV:N/AC:L/PR:L/UI:N/S:U/C:H/I:H/A:H
Version: 3.1
Base score: 8.8
Base severity: HIGH
Vector:
CVSS:3.1/AV:N/AC:L/PR:L/UI:N/S:U/C:H/I:H/A:H
Metrics Other Info
Impacts
CAPEC IDDescription
Solutions

Configurations

Workarounds

Exploits

Credits

finder
Lucio Sá
Timeline
EventDate
Disclosed2024-02-23 00:00:00
Event: Disclosed
Date: 2024-02-23 00:00:00
Replaced By

Rejected Reason

References
HyperlinkResource
https://www.wordfence.com/threat-intel/vulnerabilities/id/15cf34d8-256b-495e-9385-a5d526bfb335?source=cve
N/A
https://plugins.trac.wordpress.org/browser/addon-library/trunk/inc_php/unitecreator_actions.class.php#L39
N/A
Hyperlink: https://www.wordfence.com/threat-intel/vulnerabilities/id/15cf34d8-256b-495e-9385-a5d526bfb335?source=cve
Resource: N/A
Hyperlink: https://plugins.trac.wordpress.org/browser/addon-library/trunk/inc_php/unitecreator_actions.class.php#L39
Resource: N/A
▼Authorized Data Publishers (ADP)
1. CISA ADP Vulnrichment
Affected Products
Vendor
unitecms
Product
addon_library
CPEs
  • cpe:2.3:a:unitecms:addon_library:*:*:*:*:*:*:*:*
Default Status
unknown
Versions
Affected
  • From 0 through 1.3.76 (semver)
Metrics
VersionBase scoreBase severityVector
Metrics Other Info
Impacts
CAPEC IDDescription
Solutions

Configurations

Workarounds

Exploits

Credits

Timeline
EventDate
Replaced By

Rejected Reason

References
HyperlinkResource
2. CVE Program Container
Affected Products
Metrics
VersionBase scoreBase severityVector
Metrics Other Info
Impacts
CAPEC IDDescription
Solutions

Configurations

Workarounds

Exploits

Credits

Timeline
EventDate
Replaced By

Rejected Reason

References
HyperlinkResource
https://www.wordfence.com/threat-intel/vulnerabilities/id/15cf34d8-256b-495e-9385-a5d526bfb335?source=cve
x_transferred
https://plugins.trac.wordpress.org/browser/addon-library/trunk/inc_php/unitecreator_actions.class.php#L39
x_transferred
Hyperlink: https://www.wordfence.com/threat-intel/vulnerabilities/id/15cf34d8-256b-495e-9385-a5d526bfb335?source=cve
Resource:
x_transferred
Hyperlink: https://plugins.trac.wordpress.org/browser/addon-library/trunk/inc_php/unitecreator_actions.class.php#L39
Resource:
x_transferred
Information is not available yet
▼National Vulnerability Database (NVD)
nvd.nist.gov
Source:security@wordfence.com
Published At:26 Feb, 2024 | 16:27
Updated At:08 Apr, 2026 | 17:18

The Addon Library plugin for WordPress is vulnerable to unauthorized access of data due to a missing capability check on the onAjaxAction function action in all versions up to, and including, 1.3.76. This makes it possible for authenticated attackers, with subscriber-level access and above, to perform several unauthorized actions including uploading arbitrary files.

CISA Catalog
Date AddedDue DateVulnerability NameRequired Action
N/A
Date Added: N/A
Due Date: N/A
Vulnerability Name: N/A
Required Action: N/A
Metrics
TypeVersionBase scoreBase severityVector
Secondary3.18.8HIGH
CVSS:3.1/AV:N/AC:L/PR:L/UI:N/S:U/C:H/I:H/A:H
Type: Secondary
Version: 3.1
Base score: 8.8
Base severity: HIGH
Vector:
CVSS:3.1/AV:N/AC:L/PR:L/UI:N/S:U/C:H/I:H/A:H
CPE Matches

unlimited-elements
unlimited-elements
>>addon_library>>Versions up to 1.3.76(inclusive)
cpe:2.3:a:unlimited-elements:addon_library:*:*:*:*:*:wordpress:*:*
Weaknesses
CWE IDTypeSource
CWE-862Primarysecurity@wordfence.com
CWE-862Secondarynvd@nist.gov
CWE ID: CWE-862
Type: Primary
Source: security@wordfence.com
CWE ID: CWE-862
Type: Secondary
Source: nvd@nist.gov
Evaluator Description

Evaluator Impact

Evaluator Solution

Vendor Statements

References
HyperlinkSourceResource
https://plugins.trac.wordpress.org/browser/addon-library/trunk/inc_php/unitecreator_actions.class.php#L39security@wordfence.com
Product
https://www.wordfence.com/threat-intel/vulnerabilities/id/15cf34d8-256b-495e-9385-a5d526bfb335?source=cvesecurity@wordfence.com
Third Party Advisory
https://plugins.trac.wordpress.org/browser/addon-library/trunk/inc_php/unitecreator_actions.class.php#L39af854a3a-2127-422b-91ae-364da2661108
Product
https://www.wordfence.com/threat-intel/vulnerabilities/id/15cf34d8-256b-495e-9385-a5d526bfb335?source=cveaf854a3a-2127-422b-91ae-364da2661108
Third Party Advisory
Hyperlink: https://plugins.trac.wordpress.org/browser/addon-library/trunk/inc_php/unitecreator_actions.class.php#L39
Source: security@wordfence.com
Resource:
Product
Hyperlink: https://www.wordfence.com/threat-intel/vulnerabilities/id/15cf34d8-256b-495e-9385-a5d526bfb335?source=cve
Source: security@wordfence.com
Resource:
Third Party Advisory
Hyperlink: https://plugins.trac.wordpress.org/browser/addon-library/trunk/inc_php/unitecreator_actions.class.php#L39
Source: af854a3a-2127-422b-91ae-364da2661108
Resource:
Product
Hyperlink: https://www.wordfence.com/threat-intel/vulnerabilities/id/15cf34d8-256b-495e-9385-a5d526bfb335?source=cve
Source: af854a3a-2127-422b-91ae-364da2661108
Resource:
Third Party Advisory

Change History

0
Information is not available yet

Similar CVEs

544Records found

CVE-2024-35674
Matching Score-10
Assigner-Patchstack
ShareView Details
Matching Score-10
Assigner-Patchstack
CVSS Score-4.3||MEDIUM
EPSS-0.38% / 59.43%
||
7 Day CHG~0.00%
Published-05 Jun, 2024 | 16:19
Updated-11 May, 2026 | 21:02
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Unlimited Elements For Elementor plugin <= 1.5.109 - Broken Access Control vulnerability

Missing Authorization vulnerability in Unlimited Elements Unlimited Elements For Elementor (Free Widgets, Addons, Templates) unlimited-elements-for-elementor.This issue affects Unlimited Elements For Elementor (Free Widgets, Addons, Templates): from n/a through <= 1.5.109.

Action-Not Available
Vendor-unlimited-elementsUnlimited Elementsunlimited-elements
Product-unlimited_elements_for_elementorUnlimited Elements For Elementor (Free Widgets, Addons, Templates)unlimited_elements_for_elementor_\(free_widgets\,_addons\,_templates\)
CWE ID-CWE-862
Missing Authorization
CVE-2023-31080
Matching Score-10
Assigner-Patchstack
ShareView Details
Matching Score-10
Assigner-Patchstack
CVSS Score-8.3||HIGH
EPSS-0.39% / 60.20%
||
7 Day CHG~0.00%
Published-09 Jun, 2024 | 09:27
Updated-28 Apr, 2026 | 16:08
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Unlimited Elements For Elementor plugin <= 1.5.65 - Multiple Broken Access Control vulnerability

Missing Authorization vulnerability in Unlimited Elements Unlimited Elements For Elementor (Free Widgets, Addons, Templates).This issue affects Unlimited Elements For Elementor (Free Widgets, Addons, Templates): from n/a through 1.5.65.

Action-Not Available
Vendor-unlimited-elementsUnlimited Elements
Product-unlimited_elements_for_elementorUnlimited Elements For Elementor (Free Widgets, Addons, Templates)
CWE ID-CWE-862
Missing Authorization
CVE-2025-14476
Matching Score-8
Assigner-Wordfence
ShareView Details
Matching Score-8
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-0.20% / 41.56%
||
7 Day CHG+0.07%
Published-13 Dec, 2025 | 04:31
Updated-08 Apr, 2026 | 18:24
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Doubly <= 1.0.46 - Authenticated (Subscriber+) PHP Object Injection via ZIP File Import

The Doubly – Cross Domain Copy Paste for WordPress plugin for WordPress is vulnerable to PHP Object Injection in all versions up to, and including, 1.0.46 via deserialization of untrusted input from the content.txt file within uploaded ZIP archives. This makes it possible for authenticated attackers, with Subscriber-level access and above, to inject a PHP Object. The additional presence of a POP chain allows attackers to execute arbitrary code, delete files, retrieve sensitive data, or perform other actions depending on the available gadgets. This is only exploitable by subscribers, when administrators have explicitly enabled that access.

Action-Not Available
Vendor-unitecms
Product-Doubly – Cross Domain Copy Paste for WordPress
CWE ID-CWE-502
Deserialization of Untrusted Data
CVE-2024-6315
Matching Score-8
Assigner-Wordfence
ShareView Details
Matching Score-8
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-6.95% / 91.53%
||
7 Day CHG~0.00%
Published-06 Aug, 2024 | 01:49
Updated-15 Apr, 2026 | 00:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Blox Page Builder <= 1.0.65 - Authenticated (Contributor+) Arbitrary File Upload

The Blox Page Builder plugin for WordPress is vulnerable to arbitrary file uploads due to missing file type validation in the 'handleUploadFile' function in all versions up to, and including, 1.0.65. This makes it possible for authenticated attackers, with contributor-level and above permissions, to upload arbitrary files on the affected site's server which may make remote code execution possible.

Action-Not Available
Vendor-unitecmsunitecms
Product-Blox Page Builderblox_page_builder
CWE ID-CWE-434
Unrestricted Upload of File with Dangerous Type
CVE-2023-6743
Matching Score-8
Assigner-Wordfence
ShareView Details
Matching Score-8
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-5.83% / 90.64%
||
7 Day CHG~0.00%
Published-29 May, 2024 | 04:30
Updated-08 Apr, 2026 | 17:17
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Unlimited Elements for Elementor <= 1.5.89 - Authenticated(Contributor+) Remote Code Execution via template import

The Unlimited Elements For Elementor (Free Widgets, Addons, Templates) plugin for WordPress is vulnerable to Remote Code Execution in all versions up to, and including, 1.5.89 via the template import functionality. This makes it possible for authenticated attackers, with contributor access and above, to execute code on the server.

Action-Not Available
Vendor-unlimited-elementsunitecmsunitecms
Product-unlimited_elements_for_elementorUnlimited Elements For Elementorunlimited_elements_for_elementor
CWE ID-CWE-1336
Improper Neutralization of Special Elements Used in a Template Engine
CWE ID-CWE-94
Improper Control of Generation of Code ('Code Injection')
CVE-2024-5329
Matching Score-8
Assigner-Wordfence
ShareView Details
Matching Score-8
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-0.63% / 70.62%
||
7 Day CHG~0.00%
Published-06 Jun, 2024 | 09:34
Updated-08 Apr, 2026 | 19:21
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Unlimited Elements For Elementor (Free Widgets, Addons, Templates) <= 1.5.109 - Authenticated (Contributor+) Blind SQL Injection via data[addonID] Parameter

The Unlimited Elements For Elementor (Free Widgets, Addons, Templates) plugin for WordPress is vulnerable to blind SQL Injection via the ‘data[addonID]’ parameter in all versions up to, and including, 1.5.109 due to insufficient escaping on the user supplied parameter and lack of sufficient preparation on the existing SQL query. This makes it possible for authenticated attackers, with Contributor-level access and above, to append additional SQL queries into already existing queries that can be used to extract sensitive information from the database.

Action-Not Available
Vendor-unlimited-elementsunitecms
Product-unlimited_elements_for_elementorUnlimited Elements For Elementor
CWE ID-CWE-89
Improper Neutralization of Special Elements used in an SQL Command ('SQL Injection')
CVE-2023-31090
Matching Score-8
Assigner-Patchstack
ShareView Details
Matching Score-8
Assigner-Patchstack
CVSS Score-9.9||CRITICAL
EPSS-0.31% / 54.60%
||
7 Day CHG~0.00%
Published-24 Apr, 2024 | 15:45
Updated-28 Apr, 2026 | 16:08
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Unlimited Elements For Elementor plugin <= 1.5.60 - Unrestricted Zip Extraction vulnerability

Unrestricted Upload of File with Dangerous Type vulnerability in Unlimited Elements Unlimited Elements For Elementor (Free Widgets, Addons, Templates) allows Upload a Web Shell to a Web Server.This issue affects Unlimited Elements For Elementor (Free Widgets, Addons, Templates): from n/a through 1.5.60.

Action-Not Available
Vendor-unlimited-elementsUnlimited Elementsunlimited-elements
Product-unlimited_elements_for_elementorUnlimited Elements For Elementor (Free Widgets, Addons, Templates)unlimited_elements_for_elementor_\(free_widgets\,_addons\,_templates\)
CWE ID-CWE-434
Unrestricted Upload of File with Dangerous Type
CVE-2024-6166
Matching Score-8
Assigner-Wordfence
ShareView Details
Matching Score-8
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-0.92% / 76.17%
||
7 Day CHG~0.00%
Published-09 Jul, 2024 | 04:32
Updated-08 Apr, 2026 | 18:22
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Unlimited Elements For Elementor (Free Widgets, Addons, Templates) <= 1.5.112 - Authenticated (Contributor+) Time-Based SQL Injection

The Unlimited Elements For Elementor (Free Widgets, Addons, Templates) plugin for WordPress is vulnerable to time-based SQL Injection via the ‘addons_order’ parameter in all versions up to, and including, 1.5.112 due to insufficient escaping on the user supplied parameter and lack of sufficient preparation on the existing SQL query. This makes it possible for authenticated attackers, with Contributor-level access and above and granted plugin setting edit permissions by an administrator, to append additional SQL queries into already existing queries that can be used to extract sensitive information from the database.

Action-Not Available
Vendor-unlimited-elementsunitecmsunlimited-elements
Product-unlimited_elements_for_elementor_\(free_widgets\,_addons\,_templates\)Unlimited Elements For Elementorunlimited_elements_for_elementor_\(free_widgets\,_addons\,_templates\)
CWE ID-CWE-89
Improper Neutralization of Special Elements used in an SQL Command ('SQL Injection')
CVE-2024-4779
Matching Score-8
Assigner-Wordfence
ShareView Details
Matching Score-8
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-0.63% / 70.61%
||
7 Day CHG~0.00%
Published-23 May, 2024 | 09:32
Updated-08 Apr, 2026 | 19:21
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Unlimited Elements for Elementor <= 1.5.107 - Authenticated (Contributor+) SQL Injection via data[post_ids][0]

The Unlimited Elements For Elementor (Free Widgets, Addons, Templates) plugin for WordPress is vulnerable to SQL Injection via the ‘data[post_ids][0]’ parameter in all versions up to, and including, 1.5.107 due to insufficient escaping on the user supplied parameter and lack of sufficient preparation on the existing SQL query. This makes it possible for authenticated attackers, with contributor-level access and above, to append additional SQL queries into already existing queries that can be used to extract sensitive information from the database.

Action-Not Available
Vendor-unlimited-elementsunitecms
Product-unlimited_elements_for_elementorUnlimited Elements For Elementor
CWE ID-CWE-89
Improper Neutralization of Special Elements used in an SQL Command ('SQL Injection')
CVE-2023-3295
Matching Score-8
Assigner-Wordfence
ShareView Details
Matching Score-8
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-6.46% / 91.18%
||
7 Day CHG~0.00%
Published-17 Jun, 2023 | 01:48
Updated-08 Apr, 2026 | 17:24
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Unlimited Elements For Elementor (Free Widgets, Addons, Templates) <= 1.5.66 - Authenticated (Contributor+) Arbitrary File Upload

The Unlimited Elements For Elementor (Free Widgets, Addons, Templates) for WordPress is vulnerable to arbitrary file uploads due to missing file type validation of files in the file manager functionality in versions up to, and including, 1.5.66 . This makes it possible for authenticated attackers, with contributor-level permissions and above, to upload arbitrary files on the affected site's server which may make remote code execution possible. The issue was partially patched in version 1.5.66 and fully patched in 1.5.67. CVE-2023-31231 appears to be a duplicate of this issue.

Action-Not Available
Vendor-unlimited-elementsunitecms
Product-unlimited_elements_for_elementorUnlimited Elements For Elementor
CWE ID-CWE-434
Unrestricted Upload of File with Dangerous Type
CVE-2024-3055
Matching Score-8
Assigner-Wordfence
ShareView Details
Matching Score-8
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-0.42% / 62.03%
||
7 Day CHG~0.00%
Published-10 May, 2024 | 21:32
Updated-08 Apr, 2026 | 19:21
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Unlimited Elements For Elementor (Free Widgets, Addons, Templates) <= 1.5.102 - Authenticated (Contributor+) SQL Injection

The Unlimited Elements For Elementor (Free Widgets, Addons, Templates) plugin for WordPress is vulnerable to time-based SQL Injection via the ‘id’ parameter in all versions up to, and including, 1.5.102 due to insufficient escaping on the user supplied parameter and lack of sufficient preparation on the existing SQL query. This makes it possible for authenticated attackers, with contributor access or higher, to append additional SQL queries into already existing queries that can be used to extract sensitive information from the database.

Action-Not Available
Vendor-unlimited-elementsunitecmsunlimited-elements
Product-unlimited_elements_for_elementorUnlimited Elements For Elementorunlimited_elements_for_elementor_\(free_widgets\,_addons\,_templates\)
CWE ID-CWE-89
Improper Neutralization of Special Elements used in an SQL Command ('SQL Injection')
CVE-2022-4974
Matching Score-6
Assigner-Wordfence
ShareView Details
Matching Score-6
Assigner-Wordfence
CVSS Score-6.3||MEDIUM
EPSS-0.21% / 42.70%
||
7 Day CHG~0.00%
Published-16 Oct, 2024 | 06:43
Updated-15 Apr, 2026 | 00:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Freemius SDK <= 2.4.2 - Missing Authorization Checks

The Freemius SDK, as used by hundreds of WordPress plugin and theme developers, was vulnerable to Cross-Site Request Forgery and Information disclosure due to missing capability checks and nonce protection on the _get_debug_log, _get_db_option, and the _set_db_option functions in versions up to, and including 2.4.2. Any WordPress plugin or theme running a version of Freemius less than 2.4.3 is vulnerable.

Action-Not Available
Vendor-mantrabrainscrollsequenceclosetechnologyproteusthemessnazzythemespeterschulznljavmahbuttonizersslzenwpkubekaggdesigncyberhoboakdevsjaydeep-nimavataharonyanmhmrajibproperfractionjohnc1979oloyede-jamiuivanchernyakovmatthias-reuterkaizencodersshabtidanish-alitheafricanboss/vinod-dalviwordplusultimateblocksninjalibsmattpramschuferbrightvesseldevwalkerwpmohsinofflinexjohnykdavidandersonalekvsamdaniannastaacodeieswpsaadatakanozdaniyalahmedkkartikparmarthinleekwpscriptsjamesparkninjanitin247takanakuiethereumicoiothijziecleverpluginsoceanwpinteractivegeomapsultradevswpbitsgaloovergloriousthemespaulio21commercepunditpootlepresskoen12344bfintalchetmacwpmoosenicheaddonshalmatprasadkirpekarwpdevpowersalexmosstickeraalphabposervicefsruslanshawoninfomcurlywhiteshadowvohotv/wptravelenginewiserstepssindyakinsergeihiddenpearlsmaciejbak85wpsoulstaxwpkhothemesmoomooagencyrebelcodelynn999damian-goralostboy7glowlogixrankbearkylegilmanmaartenbelmansivan_paulinsonalsinha21unitecmstranzlywpenginewebheadllcpluginswaremajickjkohlbachrisethemepagebuildersandwichpassionatebrainswpgeniuzwpconedevlimbcodeshelob9wpjolicmbibby/jburleigh1protectyouruploadsfrostbournalleythemesanasbinmukimprinceahmedavidthemes/npluginstprintyedisonavesamuelsilvaptwoopopstherealwebdisruptkenanfallonpasyuksyntacticsekanathdashlabsltdweconnectcodewpeventpartners/gowebsmartymodulemastersggriesserjurskipippozanardogfiremaguilerasoftwoodyhaydaydanielealessandrawebmuehlemte90gkher/tobias_conraduriahs-victorbeeneebalex-yesmartwpressdejanmarkovicolezhyk5elbisnerow3scloudjwindswitcorp5starpluginsshamim51kartikparmar/bestpluginswordpresselliotvsjanwylronena100plugins360ankitmarucliffpaulickwordpresschefldninjas/anfrageformularfoopluginstobias_conrad/sebet/blockypagemuhammad-rehmandreamfoxsorsawowpmunichlinekalspartacchillichallibadhonrocksblockmeisterclosemarketing/josevegamojofywpmberdingxplodedthemesupfivthemekraftthemelocationtoddhalfpennysvovafwpdivemilukove/wupoandyabelowcodexonicsbandidodeothemesslidedeckoceascloudspongedarellwgaugesalttechnointerfacelabmumarym1985patrickgarmanwpmagicsmohammedrezqggeddemilmorcoderpresssmgteamdivisumorenaudbodstarfishwpwphrmanagersakurapixelwpcohortstevehentyjcodexwebba-agencynasirahmed9brada6mikebelsdvizheniapowerfulwpactuaryzaskdangub86imtiazrayhanmaxsdesigndipcodeirkanulivemeshjwebsollistplusahmed17inputwpeedeeskymindscebbiflexithemeswpvibesdaigo75kairaskshaikatgiladtakonisovstackpremmercesurbmamaltathemespootlepress/equalizedigitalinfosatechthemeythemeslukeseagerdiviframeworkwp-makingkartechifyzeethemesebetrafacarvalhidomelapressthemeseixyulexstreamweaselsroyalnavneetstevejburgemajick/blackandwhitedigitalmnelson4iksstudiopmbaldhapatrickposnerpluginandplayanssilaitilaversacompmaurolopes/wpchillbavokoservicestripettowpdeliciousfrenifydgwyerggwiczwpt00lsjetixwpkrsppmbaldha/essekiadrosendoco2okcypressnorthinfornwebedgegallerypluginpopeatingmilukovedotsmunirkamalusmanaliqureshibouncingsproutkkikuchi1220seezeewpeka-clublitonice13vernalwptbgreenjaymediakitthemeswplegalpagesejslondon/sj_omvvapps/tonyzeolirafalosinskimeepluginsgallerycreatormasterblockswpdevervincoitmarviorochaboriscolombier/multicollabpenguininitiativesbrandonfiresslatlasintoxstudiofastaf/mbrown24thecodechimebilaltasboltonstudiosibenicmdedevtheafricanbosscadudecastroalveswpcohort/stylingwebbenjanthielemannmarcqueraltcreativethemeshqmikewire_rocksolidbpluginszerozendesignh3technologiesfullworksivacygetsparrowcloudlivingdotrexbenmoreassynthqthemedanielisercromer12richard-bthemestymihail-barinovfoxmoonmatstarsdovyplkoudaltauhidproinvisnetsaadiqbalvanyukovtribalnerdsangarandjenhmeowcrewdudocodesavorysetkahumblethemesblockspareelementinvaderattestbycriksjavedpagupclickervoltseancarricodam6plprelctropicalistaBdThemesRoyal Elementor AddonsThe Events Calendar (StellarWP)WPWeb EliteThemeisle
Product-annasta Filters for WooCommerceBattle Suit for DiviBetter Robots.txt – AI-Ready Crawl Control & Bot GovernanceStyler Mate for Contact Form 7eaSYNC Booking – Hotels, Restaurants & Car RentalsWidget Detector for ElementorTickera – Sell Tickets & Manage EventsBlock Slider – Responsive Image Slider, Video Slider & Post SliderGloriousThemes Starter SitesGateway for PayLate on WooCommerceUltimate Post Kit Addons for ElementorDivi Content RestrictorLivemesh Addons for Beaver BuilderWidgets on Pages and PostsEvent Tickets and RegistrationWP Page TemplatesAutoSave NetAWCA – The Great Analytics Insights for Your eStoreWebinarIgnition – Live, Automated & Evergreen Webinars for WooCommerceInsert or Embed Articulate Content into WordPressForm Vibes – Database Manager for FormsQuick Contact FormLocal Delivery Drivers for WooCommerceAddon Elements for Elementor (formerly Elementor Addon Elements)Media Cloud for Bunny CDN, Amazon S3, Cloudflare R2, Google Cloud Storage, DigitalOcean and moreMenu Item SchedulerExpire tagsAdd Pinterest conversion tags for Pinterest Ads + Site verificationGA4WP – Analytics Dashboard for the WebsiteHM Multiple RolesWP Search FilterPlace Order Without Payment for WooCommerceBookPress – For Book AuthorsMusic Player for Elementor – Audio Player & Podcast PlayerPost Form – Registration Form – Profile Form for User Profiles – Frontend Content Forms for User Submissions (UGC)Bulk Attachment DownloadWordPress Dev Powers – ACF Color Coded Field Types PluginPost Carousel DiviWP Google Street View (with 360° virtual tour) & Google maps + Local SEOAutomatic Internal Links for SEO by PagupEasy Post Views CountAdvanced Page Visit Counter – Most Wanted Analytics Plugin for WordPressWordPress Gallery Plugin – Edge Photo GalleryBulk WooCommerce Category CreatorBooking Addon for WooCommerceEasy PrayerUkrposhtaPremmerce Variation Swatches for WooCommerceThe Events CalendarTK Google Fonts GDPR CompliantGuest posting / Frontend Posting / Front Editor – WP Front User SubmitDuplicate Variations for WoocommerceCF7 Constant Contact Fields MappingGeo MashupReplyable – Subscribe to Comments and Reply by EmailWP Photo EffectsMenu Image, Icons made easyAwesome SSLFiboSearch – Ajax Search for WooCommerceProduct Image Watermark for WooBetter SharingPremmerceRT Easy Builder – Advanced addons for ElementorAll-in-One Video GalleryTinyMCE AnnotateKVoucherWP fail2ban – Advanced SecurityDa ReactionsPayment Gateway for PayFabricNotification Bar, Announcement and Cookie Notice WordPress Plugin – FooBarNotifSMS – SMS Notifications OTP & 2FA for WordPress & WooCommerceWP Easy Pay – Payment and Donation form Builder for SquareConversion de moneda WoocommerceCustomers Table for WooCommerce: View, Search, Bulk EditorSchema Plugin For Divi, Gutenberg & ShortcodesMaster Accordion ( Former WP Awesome FAQ Plugin )Masonry Gallery & Posts For Divi (WP Tools)Blocksy CompanionRoyal Addons for Elementor – Addons and Templates Kit for ElementorBlockSpare — News, Magazine and Blog Addons for (Gutenberg) Block EditorWP Get PersonalPost Slider and Post Carousel with Post Vertical Scrolling Widget – A Responsive Post SliderGet Better Reviews for WooCommerceInbound BrewSimple Feature Requests Free – User Feedback BoardAnfrageformular – Multi Step Drag & Drop Formular Builder – LeadgenerierungEqualize Digital Accessibility Checker – WCAG, ADA, EAA and Section 508 complianceWordPress Coupon Plugin for Bloggers and Marketers – WP OffersEasy Code SnippetsDeMomentSomTres AddressDeMomentSomTres Media Tools AutoMarket ExporterWP GratifyHQTheme ExtraSlideDeck: Responsive WordPress Slider PluginMulti Page Auto Advance for Gravity FormsWP BugBotDeals of the Day WooCommercebbResolutionsSmart Variations Images & Swatches for WooCommercePremmerce Wishlist for WooCommerceRevolution for ElementorEasy Social Feed – Social Photos Gallery and Post Feed for WordPressPayment Gateway Per Product for WooCommerceWP Notification BellHelpie FAQ — Accordion, Docs & Knowledge BaseFrontend group restriction for LearnDashWidgets for WooCommerce Products on ElementorNugget by Ingot: Easy, automated and native A/B testing for everyoneGreenshift – animation and page builder blocksSTEWoo – Super Transactional Emails for WooCommerceThe best plugin for restrict content, support all Custom Post Types and Elementor – Password ProtectedFlat Rate Shipping Method for WooCommerceSimple Sitemap – Create a Responsive HTML SitemapClickerVolt – Affiliate Links & Click Tracking for Performance MarketersWooCommerce Next Order CouponNEXUSCAPTCHA 4WP – Antispam CAPTCHA solution for WordPressWP Relevant AdsIks Menu – WordPress Category Accordion Menu & FAQsWP Data Access – App Builder for Tables, Forms, Charts, Maps & DashboardsMarijuana Age VerifyWooCommerce upcoming ProductsEvents Calendar RegistrationChoice Payment Gateway for WooCommerceFilr – Secure document libraryWOW Styler for CF7 – Visual Styler for Contact Form 7 FormsPage Builder Sandwich – Front End WordPress Page Builder PluginBetter Addons for ElementorCuisine PalaceSVG Flags – Beautiful Scalable Flags For All Countries!VidSEO – Video transcript embedding for WordPress & LLMRating-Widget: Star Review SystemCryptocurrency Product for WooCommerceNew User ApproveUnakitGo Fetch Jobs (for WP Job Manager)Pixel Manager for WooCommerce – Conversion Tracking, Google Ads, GA4, TikTok, Dynamic RemarketingAutomizy Gravity FormsRaCar Clear Cart for WooCommerceWP-HR Manager: The Human Resources Plugin for WordPressReally Simple Featured Video – Featured Video Support for Posts, Pages & WooCommerce ProductsWordPress Auto SEO Plugin – Upfiv SEO WizardCookie Banner for GDPR / CCPA – WPLP Cookie ConsentFunnelmentalsShipping Gateway Per Product for WooCommerceDeMomentSomTres Grid ArchiveLicense Manager for WooCommerceVit Website ReviewsLawPress – Law Firm Website ManagementSpeculorAquarella LiteJoli Table Of ContentsWP Travel Engine – Tour Booking Plugin – Tour Operator SoftwareReset Course Progress For LearnDashResponsive Social Slider WidgetNitek Carousel Slider Cool TransitionsNumber ChatStreamWeasels Twitch IntegrationTreePress – Easy Family Trees & Ancestor ProfilesEvents Addon for ElementorContact List – Online Staff Directory & Address BookProtect Uploads with Login – Protect Your UploadsFrontend Admin by DynamiAppsWholesale for WooCommerceFull Page Blog DesignerAgy – Age verification for WooCommerceEthereumICOFuse Social Floating SidebarMOBILOOK — Mobile View & Mobile‑Friendly TestServer InfoCategorify – WordPress Media Library Category & File ManagerWUPO Group Attributes for WooCommerceLMS Plugin – eLearning, Online Courses by AttestMixed Media Gallery BlocksWordPress Slider Block GutensliderBlog Sidebar WidgetOcean ExtraNicheTable – Responsive Comparison Table BlockGlossaryConeBlog – Elementor Blog WidgetsXT Floating Cart for WooCommerceAEH Speed Optimization: Browser Cache, Optimized Minify, Lazy Loading & Image OptimizationUnder ConstructionElationAll in One Invite CodesLittleBot InvoicesUltra Elementor AddonsCustom Registration and Custom Login Forms with New RecaptchaMedia Library File DownloadSecure IP LoginsDomain Mapping System | Create Microsites with Multiple Alias Domains (multisite optional)Team Members – A WordPress Team Plugin with Gallery, Grid, Carousel, Slider, Table, List, and MoreClean Social IconsCoupon Affiliates – Affiliate Plugin for WooCommerceCountry Based Payments for WooCommerceFooter Plugin for DiviImage Carousel For DiviAge Verification Screen for WooCommerceDelivery for WooCommercePrice Bands for WooCommercePootle Pagebuilder – WordPress Page builderSEO Audit – WP Site AuditorSocial Gallery LiteContact Form 7 – Capsule CRM – IntegrationEverseCustom Login Page CustomizerRun time Image resizingBookit — Booking & Appointment CalendarFive-Star Ratings ShortcodeWordPress Everse Starter Sites – Elementor TemplatesSurveyFunnel – Survey Plugin for WordPressGutenberg Blocks – ACF Blocks SuiteWP Disable SitemapPro Broken Links MaintainerCustom WooCommerce Checkout Fields EditorAdd Tiktok Pixel for Tiktok ads (+Woocommerce)Security SafeFeedpress Generator – External RSS Frontend CustomizerModern Designs for Gravity FormsACF for WooCommerce ProductFile Manager for Google Drive – Integrate Google DriveAirpressDynamic Pricing and Discount Rules for WooCommerceBetter Messages – Integration for WC Vendors MarketplaceLightbox & Modal Popup WordPress Plugin – FooBoxDancePress (TRWA)SKT Templates – 100% Free Templates for Elementor & GutenbergAdvanced Classifieds & Directory ProListPlus – Unlimited Listing DirectoryUltimate Widgets LightPanorama – 360 Virtual Tour, Panoramic image viewer and MoreUltimeterQyrr – simply and modern QR-Code creationChange Price Title for WooCommerceCheckout with Cash App on EDDSV Tracking ManagerPodcast Box – Best Podcasting Plugin for WordPressElements for LifterLMSPassster – Password Protect Pages and ContentVillarAds.txt & App-ads.txt Manager for WordPressEasy Smooth Scroll Links – Smooth Scrolling AnchorLocalSEOMapWordPress form builder plugin for contact forms, surveys and quizzes – TripettoBlock, Suspend, Report for BuddyPressAdd Twitter Pixel for Twitter adsPremmerce Multi-currency for WoocommerceXT Quick View for WooCommercePrimary Addon for ElementorClimateClick: Climate Action for allFocus on Reviews for WooCommerceFeatured Images in RSS for Mailchimp & MoreSEO BoosterPremmerce Product Filter for WooCommerceBook BuyBack PricesWPGSI: Spreadsheet IntegrationSSL Atlas – Free SSL Certificate & HTTPS Redirect for WordPressWP Group PromoterFast WordPressPost Snippets – Custom WordPress Code Snippets CustomizerImage Alt Text Manager – Bulk & Dynamic Alt Tags For image SEO Optimization + AIActivity Log For MainWPHasiumBlocked in China | Check if your site is available in the Chinese mainlandElastaFeatured Products First for WooCommerce – A Extension of WooCommerce (WooCommerce Addon Plugin)Display Eventbrite EventsWP Affiliate DisclosureRestaurant & Cafe Addon for ElementorTeam Collaboration & Content Workflow Plugin for WordPress Editorial Teams – MulticollabWordPress Animation Plugin – Animated EverythingWP Encryption – One Click Free SSL Certificate & SSL / HTTPS Redirect, Security & SSL ScanContact Form 7 Multi-Step FormsWoocommerce Customer Reviews with Artificial Intelligence analyzis, with IBM Watson Tone AnalyzerPower Ups for ElementorWP Lead StreamVideopackWordPress Translation plugin for Post, Pages & WooCommerce products. Tranzly IO AI DeepL automatic WordPress Translator.Auto SEO META keywords (META tags keywords) optimization + WooCommerceBulk Edit Coupons for WooCommerce – WP Sheet EditorWooCommerce PayPlugRW Divi Unite GalleryWP Tools Divi Product CarouselQuick Affiliate StorePremmerce Permalink Manager for WooCommercePremmerce WooCommerce Customers ManagerWP Sessions Time Monitoring Full AutomaticWP Dev Powers – Display Screen Dimensions to Admin PluginAbeta Link PunchOutScrollsequence – Cinematic Scroll Image Animation PluginPremmerce Redirect ManagerYT Player – Embed and Customize Video PlayersPremmerce Wholesale Pricing for WooCommerceDelete Duplicate Postskk Star Ratings – Rate Post & Collect User FeedbacksDelete Posts automaticallyDrip Feed Content Extended for LearndashMaster Blocks – Gutenberg Site BuilderStation Pro – Advanced Audio Streaming & Player for WordPressWordPress SEO ChecklistOverlay Image Divi ModuleAnt Admin Notices for TeamAmelaSuper Video player – Fully Customizable Video Player with PlaylistWP Conference ScheduleEasy Math Captcha for CF7OpenseaXT Ajax Add To Cart for WooCommerceTiered Pricing Table for WooCommerceBulk Auto Image Alt Text (Alt tag, Alt attribute) optimizer (image SEO)Code ManagerWidget for Contact form 7StoreCustomizer – A plugin to Customize all WooCommerce PagesPopOverXYZ – Show Light Weight Beautiful Tool Tips On Any TextProduct Author for WooCommerceMaster Addons For Elementor – Widgets, Extensions, Theme Builder, Popup Builder & Template KitsPurusCaxton – Create Pro page layouts in GutenbergSalon Booking System – Free VersionWP School CalendarQuick Event ManagerWP Meta and Date RemoverTopNewsWp – Display Tikcer News, RSS Feed Widget and Many MoreWordPress Google TranslateAFI – The Easiest Integration PluginVO Store Locator – WP Store Locator PluginWS BootstrapPast Events ExtensionEasy Appointment Booking & Scheduling System – Webba Booking CalendarMultisite Robots.txt ManagerWPOptin – AI-Powered Top Bars, PopUps & Lead GenerationBlog Designer Pack – Blog, Post Grid, Post Slider, Post Carousel, Category Post, NewsShare This ImageRedirection for Contact Form 7Education Addon for ElementorShubanChat Button- Leads and Order over ChatAutomatic YouTube GalleryGenealogical Tree – Family Tree & Ancestry for WordPressWP Frontend ProfileGet feedback from visitors – WP Feedback Suite PluginInternal Link Juicer: SEO Auto Linker for WordPresswGauge – Free VersionViralikeSocialMark – Easy Watermark/Logo on Social Media Post Link Share PreviewImpexium Single Sign OnURL Shortify – Simple and Easy URL ShortenerTablesome Table – Contact Form DB – WPForms, CF7, Gravity, Forminator, FluentBlockMeister – Block Pattern BuilderFAQ Manager For Divi, Gutenberg Block & ShortcodeHooked Editable ContentPowerFolio – Portfolio & Image Gallery for ElementorRadio Player – Live Shoutcast, Icecast and Any Audio Stream PlayerPreloader for DiviError Log MonitorLive Drag and Drop Builder for Contact Form 7Better Messages – Live Chat, Chat Rooms, Real-Time Messaging & Private MessagesPremmerce User RolesWordPress Dev Powers – Element Selector jQuery Powers PluginDivi Gravity Forms (WP Tools)WordPress WooCommerce Sync for Google SheetPurosaWP MooseWP Activity LogComments Not Replied ToPledged Plugins Secure Gateway for Authorize.net and WooCommerceWP Table Builder – Drag & Drop Table BuilderAdvanced Database ReplacerEthPress – Web3 LoginTarot Card OracleGFireM Action AfterNokkeChange Prices with Time for WooCommerceSnazzyAdmin WP Admin ThemeModern Addons for Elementor Page BuilderHuCommerce | Magyar kiegészítések WooCommerce webáruházakhozSend Prebuilt EmailsAlley Business ToolkitProduct Attachment for WooCommercejav's – WooCommerce and Trello integration WooTrelloOrder and Inventory Manager for WooCommerceWalker CorePremmerce Product Search for WooCommerceSync eCommerce NEOUltimate Divi Modules Suite – Divi Sumo LiteWP Books Gallery – Build Stunning Book Showcases & Libraries in MinutesZip Code RedirectSurbma | GDPR Proof Cookie Consent & Notice BarProduct Options and Price Calculation Formulas for WooCommerce – Uni CPOProduct Customer List for WooCommerceStop Contact Form 7 Spam & WPForms Spam – Free ProtectionEasy Newsletter SignupsRest Routes – Custom Endpoints for WordPress REST APIBulk Edit Categories and Tags – Create Thousands Quickly on the EditorCP Simple NewsletterMeridiaSimple Social Page Widget & ShortcodeAidWP – Donation & Payment Forms (Stripe Powered)Multipurpose Gutenberg BlockBulk Edit Posts and Products in SpreadsheetWP Free SSLStreak CRM For Gmail For Contact Form 7 – WordPress PluginLivemesh SiteOrigin WidgetsRun Contests, Raffles, and Giveaways with ContestsWPFrontend Admin – Add and edit posts, pages, users and more all from the frontendCourt Reservation – Manage Your Court Bookings OnlineWordPress Directory Plugin For Business Listings – WP Local PlusEnhanced Ecommerce Google Analytics for WooCommerceKnowledge Base documentation & wiki plugin – BasePress DocsAtlas – Knowledge BaseWP Author BioUltimate Carousel For DiviWoocommerce Customers Order HistoryStore Toolkit – WooCommerce Extensions, Quick Enhancements & Handy ToolsBrandAny Popup – Popup Forms, Optins & AdsAdvanced Menu Manager Pro – Built for Content-heavy WordPress Sites to Add, Filter, Lock, and Edit Menus EasilySticky add to cart for WooWP EmailyEU VAT Assistant for WooCommerceLittleBot ACH for Stripe + PlaidWPMailer – The best mail builder, No More Core for your emails support Elementor, CF7 forms etc…TwentyFourth WP ScraperSocial KitButtonizer – Floating Menus, Sticky Buttons, & Popup BuilderFast Checkout for WooCommerceBanner Management, Product Slider, Product Carousel for WooCommerceBlockyPage – Gutenberg Based Page BuilderEthereum WalletPage Builder for Gutenberg – StarterBlocksGFireM Advance SearchRadio Station by netmix® – Manage and play your Show Schedule in WordPress!JDs PortfolioContent Aware Sidebars – Fastest Widget Area PluginCartPops – High Converting Add To Cart Popup For WooCommerceBuilder for WooCommerce product reviews shortcodes – ReviewShortQuick Paypal PaymentsOne Click LoginRestrict – membership, site, content and user access restrictions for WordPressDrop Shadow BoxesNicheBaseYatri ToolsBAVOKO SEO Tools – All-in-One WordPress SEOPremmerce SEO for WooCommerceRevivePress – Keep your Old Content EvergreenCartoon UrlBlock Styler For Gravity FormsStrumenti Partita IVA per WoocommerceSheetPress – Manage WordPress Meta data with Google SheetsProduct Size Charts Plugin for WooCommerceExtend Filter Products By Price WidgetEasy TikTok Feed – TikTok Video, Feed & Gallery PluginPost List Designer – Category Post, Recent Post, Post ListWP Coupons and Deals – Coupon Plugin For Affiliate MarketersGiveaways for woocommerceMass Pages/Posts CreatorUser Menus – Nav Menu VisibilityPage Builder Gutenberg Blocks – Kioken BlocksPrime Mover – Migrate WordPress Website & BackupsSSL Zen — SSL Certificate Installer & HTTPS RedirectsWPBITS Addons For Elementor Page BuilderLive TV Player – Worldwide Live TV Channels Player for WordPressDigital Goods (Checkout Field Editor) for WooCommerce CheckoutBaniSky Login RedirectWP Delicious – Recipe Plugin for Food Bloggers (formerly Delicious Recipes)Connect WooCommerce Shop to ERP/CRM, Verifactu and EU/VAT ComplianceWPVisitorInfo – Show Visitor Information & Conditional Data Based On That InformationStackable – Page Builder Gutenberg BlocksAvailability Datepicker – Booking Calendar for Contact Form 7 – Input WPGenerate Images (AI) – Magic Post ThumbnailGrid & Styler For Contact Form 7 And DiviYASR – Yet Another Star Rating Plugin for WordPressPay For Post with WooCommerceWP SPID ItaliaEther and ERC20 tokens WooCommerce Payment GatewayRestrict User Access – Ultimate Membership & Content ProtectionNinja Libs Amazon SESMailChimp ManagerGallery by FooGallerySQL Reporting Services – SSRS Plugin for WordPressSimple SponsorshipsWoo Admin Product NotesWC Shop Sync – Square Payment Gateway and Product Synchronization for WooCommerceProduct Carousel For WooCommerce – WoorouSellPostcode RedirectFullscreen MenuBulk Edit and Create User Profiles – WP Sheet EditorXT Variation Swatches for WooCommerceDocument Viewer – Embed Word, Excel, PowerPoint & PDFs InstantlyPrime Slider – Addons for ElementorPremmerce Brands for WooCommerceWP Adminify – White Label WordPress, Admin Menu Editor, Login CustomizerJoli FAQ SEO – WordPress FAQ PluginWP Tools Divi Blog CarouselUltimate Gutenberg – Custom Block TemplatesDivi Torque Lite – Divi Theme, Divi Builder & Extra ThemeCodeKit – Custom Codes EditorAPPExperts – Mobile App Builder for WordPress | WooCommerce to iOS and Android AppsFIT: Featured Image ToolkitConnected SermonsKikote – Location Picker at Checkout & Google Address AutoFill Plugin for WooCommerceGet Directions MapShared Files – Frontend File Upload Form & Secure File SharingWP Comment Cleaner – Delete All Comments, Disable Comments, Bulk Delete & Remove CommentsPinblocks — Gutenberg blocks with Pinterest widgetsGlorious Services & SupportBuddyPress WooCommerce My Account Integration. Create WooCommerce Member PagesWP Mobile Menu – The Mobile-Friendly Responsive MenuWordPress Reviews by ReviewPressAdd Linkedin insight tags for Linkedin adsConsultPress LiteWP Required Taxonomies – Categories and Tags MandatoryA no-code page builder for beautiful performance-based contentUltimate Bulk SEO Noindex Nofollow – Speed up Penalty Recovery Ultimate SEO BoosterHide Shipping Method For WooCommerceShipping Method Display Style for WooCommerceLightbox – EverlightBox GalleryLogo Showcase – Responsive Logo Carousel, Logo Slider & Logo GridSV Proven ExpertDynific Addons for Elementor (formerly AnyWhere Elementor)Wadi SurveyRemove Add to Cart WooCommerceazw woocommerce file uploadsWp My Admin BarGuestofy – Restaurant Reservations Plugin, Room Planer, Reservation FormGFireM Fields3D Viewer – Display Interactive 3D ModelsFeedbackScout: The easiest way to collect, prioritise, manage and track customer feedback.Fraud Prevention For WooCommerce and EDDCryptocurrency Portfolio TrackerКнопка ЮMoneyTag Groups is the Advanced Way to Display Your Taxonomy TermsWP Munich Blocks – Gutenberg Blocks for WordPressStreamCast – Live Radio Streaming PlayerWP AutoMedicW3SCloud Contact Form 7 to Zoho CRMWP Event Partners – WordPress Plugin for Event and Conference ManagementFood Store – Online Food Delivery & PickupXT Points & Rewards for WooCommerceRocket Maintenance Mode & Coming Soon PageSpotlight Social Feeds – Block, Shortcode, and WidgetForceFieldForms to Zapier, Integromat, IFTTT, Workato, Automate.io, elastic.io, Built.io, APIANT, WebhookPrint My Blog – Print, PDF, & eBook Converter WordPress PluginRecurWP – WordPress Recurly Payment GatewayLimb Gallery | Create Beautiful Image & Video GalleriesOut of stock display for woocommercePersistent LoginAnnouncement & Notification Banner – BulletinLearnMoreIvory Search – WordPress Search PluginImage Photo Gallery Final Tiles GridEasy Settings for LearnDashWP Radio – Worldwide Online Radio Stations Directory for WordPressBefore and After Product Images for WooCommerceScheduled Notification BarWoowGallerySTAX Header BuilderWP-Cron Status CheckerGo Viral – social share, social sharebar, social locker, social chat, open graph, reactions, share & view countersBulk Auto Image Title Attribute (Image Title tag) optimizer (Image SEO)Justified GalleryWPBakery Page Builder Addons by LivemeshEasy Zillow ReviewsTabs with Recommended Posts (Widget)WP SierraFront End PMWP Frontend Admin – Display WP Admin Pages in the FrontendEmail TrackerPerformance KitEmail Header FooterWP Post BlockSimple Giveaways – Grow your business, email lists and traffic with contestsCheckout with Zelle on WoocommerceThank You Page for WooCommerceMapGeo – Interactive Geo MapsPost to Google My Business (Google Business Profile)WP Link BioAdFoxly – Ad Manager, AdSense Ads & Ads.txtPoints Management System For Gamification, Ranks, Badges, and Loyalty Rewards Program – myCredKRSP Frontend File UploaderUltimate Blocks – 25+ Gutenberg Blocks for Block EditorStarfish Review Generation & Marketing for WordPressB2B Request a QuoteLivemesh Addons by ElementorWP Contact Slider – Contact Form Slider WidgetTK SmugMug Slideshow ShortcodeEmails Blacklist for Everest FormsCoinbase Commerce – Crypto Gateway for WooCommerceUnlimited Elements For ElementorWooCommerce Variation Swatches for ProductsWCC SEO Keyword ResearchRankBearGift Message for WooCommerceSouth Pole: Climate action nowWidgets on PagesContact Widgets For Elementor all the contact links you need in one placeSecurity Ninja – WordPress Security & FirewallProduct Country Restrictions for WooCommerce – Country CatalogsGallery PhotoBlocksWordPress Buffer – HYPESocial. Social Media Auto Post, Social Media Auto Publish and ScheduleFloating Social Share Icons and Social Share buttons – Next Previous Post Links – FLSparrow: Product Reviews and Ratings for WooCommerceLive Scores for SportsPressBroadcast LiteAffiliate Link Builder Plugin for Amazon Associates – Review EngineBulk Edit Products for WooCommerce – WP Sheet EditorDivi CollageEasy Age VerifyDisable Payment Methods based on cart conditions for WooCommerceDashy – Google Analytics advanced dashboardCheckout with Venmo on EDDWP Smart Export (Free)Better Messages – WCFM IntegrationAdvanced Custom Fields options import/exportTurbo WidgetsArendelleExtra Fees for WooCommerce
CWE ID-CWE-862
Missing Authorization
CVE-2021-44233
Matching Score-4
Assigner-SAP SE
ShareView Details
Matching Score-4
Assigner-SAP SE
CVSS Score-8.8||HIGH
EPSS-0.41% / 61.23%
||
7 Day CHG~0.00%
Published-14 Dec, 2021 | 15:44
Updated-04 Aug, 2024 | 04:17
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

SAP GRC Access Control - versions V1100_700, V1100_731, V1200_750, does not perform necessary authorization checks for an authenticated user, which could lead to escalation of privileges.

Action-Not Available
Vendor-SAP SE
Product-access_controlSAP GRC Access Control
CWE ID-CWE-862
Missing Authorization
CVE-2025-2075
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-11.58% / 93.73%
||
7 Day CHG~0.00%
Published-04 Apr, 2025 | 04:21
Updated-08 Apr, 2026 | 17:04
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Uncanny Automator <= 6.3.0.2 - Missing Authorization to Authenticated (Subscriber+) Privilege Escalation

The Uncanny Automator – Easy Automation, Integration, Webhooks & Workflow Builder Plugin for WordPress is vulnerable to Privilege Escalation in all versions up to, and including, 6.3.0.2. This is due to add_role() and user_role() functions missing proper capability checks performed through the validate_rest_call() function. This makes it possible for unauthenticated attackers to set the role of arbitrary users to administrator granting full access to the site, though privilege escalation requires an active account on the site so this is considered an authenticated privilege escalation.

Action-Not Available
Vendor-Uncanny Owl Inc.
Product-uncanny_automatorUncanny Automator – Easy Automation, Integration, Webhooks & Workflow Builder Plugin
CWE ID-CWE-862
Missing Authorization
CVE-2025-15390
Matching Score-4
Assigner-VulDB
ShareView Details
Matching Score-4
Assigner-VulDB
CVSS Score-5.3||MEDIUM
EPSS-0.02% / 5.69%
||
7 Day CHG~0.00%
Published-31 Dec, 2025 | 15:32
Updated-24 Feb, 2026 | 07:17
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
PHPGurukul Small CRM edit-user.php authorization

A security flaw has been discovered in PHPGurukul Small CRM 4.0. This impacts an unknown function of the file /admin/edit-user.php. The manipulation results in missing authorization. It is possible to launch the attack remotely. The exploit has been released to the public and may be used for attacks.

Action-Not Available
Vendor-PHPGurukul LLP
Product-small_crmSmall CRM
CWE ID-CWE-862
Missing Authorization
CWE ID-CWE-863
Incorrect Authorization
CVE-2025-1667
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-0.11% / 29.62%
||
7 Day CHG~0.00%
Published-15 Mar, 2025 | 03:23
Updated-08 Apr, 2026 | 19:23
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
School Management System – WPSchoolPress <= 2.2.16 - Missing Authorization to Privilege Escalation via Account Takeover

The School Management System – WPSchoolPress plugin for WordPress is vulnerable to Privilege Escalation due to a missing capability check on the wpsp_UpdateTeacher() function in all versions up to, and including, 2.2.16. This makes it possible for authenticated attackers, with teacher-level access and above, to update arbitrary user details including email which makes it possible to request a password reset and access arbitrary user accounts, including administrators.

Action-Not Available
Vendor-igexsolutionsjdsofttech
Product-wpschoolpressSchool Management System – WPSchoolPress
CWE ID-CWE-639
Authorization Bypass Through User-Controlled Key
CWE ID-CWE-862
Missing Authorization
CVE-2025-1639
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-11.10% / 93.56%
||
7 Day CHG~0.00%
Published-04 Mar, 2025 | 03:38
Updated-08 Apr, 2026 | 17:34
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Animation Addons for Elementor Pro <= 1.6 - Missing Authorization to Authenticated (Subscriber+) Arbitrary Plugin Installation/Activation

The Animation Addons for Elementor Pro plugin for WordPress is vulnerable to unauthorized arbitrary plugin installation due to a missing capability check on the install_elementor_plugin_handler() function in all versions up to, and including, 1.6. This makes it possible for authenticated attackers, with Subscriber-level access and above, to install and activate arbitrary plugins which can be leveraged to further infect a victim when Elementor is not activated on a vulnerable site.

Action-Not Available
Vendor-crowdythemecrowdyTheme
Product-arolaxAnimation Addons for Elementor Pro
CWE ID-CWE-862
Missing Authorization
CVE-2025-1657
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-0.11% / 29.47%
||
7 Day CHG~0.00%
Published-15 Mar, 2025 | 02:22
Updated-08 Apr, 2026 | 17:20
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Directory Listings WordPress plugin – uListing <= 2.2.0 - Missing Authorization to Authenticated (Subscriber+) Arbitrary Post Meta Update and PHP Object Injection

The Directory Listings WordPress plugin – uListing plugin for WordPress is vulnerable to unauthorized modification of data and PHP Object Injection due to a missing capability check on the stm_listing_ajax AJAX action in all versions up to, and including, 2.2.0. This makes it possible for authenticated attackers, with subscriber-level access and above, to update post meta data and inject PHP Objects that may be unserialized. A capability check was added in 2.1.8, but the unserialize is still present.

Action-Not Available
Vendor-stylemixthemesstylemix
Product-ulistingDirectory Listings WordPress plugin – uListing
CWE ID-CWE-862
Missing Authorization
CVE-2024-27950
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-5.4||MEDIUM
EPSS-0.15% / 35.52%
||
7 Day CHG~0.00%
Published-01 Mar, 2024 | 07:46
Updated-11 May, 2026 | 20:53
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress Sirv plugin <= 7.2.0 - Broken Access Control vulnerability

Missing Authorization vulnerability in Sirv CDN and Image Hosting Sirv sirv.This issue affects Sirv: from n/a through <= 7.2.0.

Action-Not Available
Vendor-sirvSirv CDN and Image Hosting
Product-sirvSirv
CWE ID-CWE-862
Missing Authorization
CVE-2025-15406
Matching Score-4
Assigner-VulDB
ShareView Details
Matching Score-4
Assigner-VulDB
CVSS Score-5.3||MEDIUM
EPSS-0.02% / 5.69%
||
7 Day CHG~0.00%
Published-01 Jan, 2026 | 17:02
Updated-23 Feb, 2026 | 08:02
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
PHPGurukul Online Course Registration authorization

A flaw has been found in PHPGurukul Online Course Registration up to 3.1. This affects an unknown function. This manipulation causes missing authorization. Remote exploitation of the attack is possible. The exploit has been published and may be used.

Action-Not Available
Vendor-PHPGurukul LLP
Product-online_course_registrationOnline Course Registration
CWE ID-CWE-862
Missing Authorization
CWE ID-CWE-863
Incorrect Authorization
CVE-2025-15330
Matching Score-4
Assigner-3938794e-25f5-4123-a1ba-5cbd7f104512
ShareView Details
Matching Score-4
Assigner-3938794e-25f5-4123-a1ba-5cbd7f104512
CVSS Score-8.8||HIGH
EPSS-0.02% / 6.62%
||
7 Day CHG~0.00%
Published-05 Feb, 2026 | 18:24
Updated-10 Feb, 2026 | 17:28
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Tanium addressed an improper input validation vulnerability in Deploy.

Tanium addressed an improper input validation vulnerability in Deploy.

Action-Not Available
Vendor-taniumTanium
Product-deployDeploy
CWE ID-CWE-862
Missing Authorization
CVE-2025-14364
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-0.05% / 16.88%
||
7 Day CHG-0.00%
Published-18 Dec, 2025 | 09:21
Updated-08 Apr, 2026 | 17:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Demo Importer Plus <= 2.0.8 - Missing Authorization to Authenticated (Subscriber+) Site Reset and Privilege Escalation

The Demo Importer Plus plugin for WordPress is vulnerable to unauthorized modification of data, loss of data, and privilege escalation due to a missing capability check on the Ajax::handle_request() function in all versions up to, and including, 2.0.8. This makes it possible for authenticated attackers, with Subscriber-level access and above, to trigger a full site reset, dropping all database tables except users/usermeta and re-running wp_install(), which also assigns the Administrator role to the attacking subscriber account.

Action-Not Available
Vendor-kraftplugins
Product-Demo Importer Plus
CWE ID-CWE-862
Missing Authorization
CVE-2025-14386
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-0.14% / 34.26%
||
7 Day CHG~0.00%
Published-28 Jan, 2026 | 11:23
Updated-29 Jan, 2026 | 16:31
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Search Atlas SEO – Premier SEO Plugin for One-Click WP Publishing & Integrated AI Optimization 2.4.4 - 2.5.12 - Missing Authorization to Authenticated (Subscriber+) Authentication Bypass via Account Takeover

The Search Atlas SEO – Premier SEO Plugin for One-Click WP Publishing & Integrated AI Optimization plugin for WordPress is vulnerable to authentication bypass due to a missing capability check on the 'generate_sso_url' and 'validate_sso_token' functions in versions 2.4.4 to 2.5.12. This makes it possible for authenticated attackers, with Subscriber-level access and above, to extract the 'nonce_token' authentication value to log in to the first Administrator's account.

Action-Not Available
Vendor-shahrukhlinkgraph
Product-Search Atlas SEO – Premier SEO Plugin for One-Click WP Publishing & Integrated AI Optimization
CWE ID-CWE-862
Missing Authorization
CVE-2025-14397
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-0.06% / 17.48%
||
7 Day CHG+0.01%
Published-13 Dec, 2025 | 04:31
Updated-08 Apr, 2026 | 16:41
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Postem Ipsum <= 3.0.1 - Missing Authorization to Authenticated (Subscriber+) Privilege Escalation in postem_ipsum_generate_users

The Postem Ipsum plugin for WordPress is vulnerable to unauthorized modification of data to Privilege Escalation due to a missing capability check on the postem_ipsum_generate_users() function in all versions up to, and including, 3.0.1. This makes it possible for authenticated attackers, with Subscriber-level access and above, to create arbitrary user accounts with the administrator role.

Action-Not Available
Vendor-franciscopalacios
Product-Postem Ipsum
CWE ID-CWE-862
Missing Authorization
CVE-2025-1309
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-0.18% / 38.97%
||
7 Day CHG~0.00%
Published-07 Mar, 2025 | 07:22
Updated-15 Apr, 2026 | 00:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
UiPress lite | Effortless custom dashboards, admin themes and pages <= 3.5.04 - Missing Authorization to Authenticated (Subscriber+) Arbitrary Options Update

The UiPress lite | Effortless custom dashboards, admin themes and pages plugin for WordPress is vulnerable to unauthorized modification of data that can lead to privilege escalation due to a missing capability check on the uip_save_form_as_option() function in all versions up to, and including, 3.5.04. This makes it possible for authenticated attackers, with Subscriber-level access and above, to update arbitrary options on the WordPress site. This can be leveraged to update the default role for registration to administrator and enable user registration for attackers to gain administrative user access to a vulnerable site.

Action-Not Available
Vendor-admintwentytwenty
Product-UiPress lite | Effortless custom dashboards, admin themes and pages
CWE ID-CWE-862
Missing Authorization
CVE-2025-1304
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-1.54% / 81.61%
||
7 Day CHG~0.00%
Published-01 May, 2025 | 03:23
Updated-08 Apr, 2026 | 17:04
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
NewsBlogger <= 0.2.5.1 - Authenticated (Subscriber+) Arbitrary File Upload

The NewsBlogger theme for WordPress is vulnerable to arbitrary file uploads due to a missing capability check on the newsblogger_install_and_activate_plugin() function in all versions up to, and including, 0.2.5.1. This makes it possible for authenticated attackers, with subscriber-level access and above, to upload arbitrary files on the affected site's server which may make remote code execution possible.

Action-Not Available
Vendor-spicethemesspicethemes
Product-newsbloggerNewsBlogger
CWE ID-CWE-862
Missing Authorization
CVE-2025-13603
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-0.06% / 18.69%
||
7 Day CHG~0.00%
Published-19 Feb, 2026 | 04:36
Updated-08 Apr, 2026 | 17:04
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WP AUDIO GALLERY <= 2.0 - Authenticated (Subscriber+) Arbitrary File Read via .htaccess Manipulation

The WP AUDIO GALLERY plugin for WordPress is vulnerable to Unauthorized Arbitrary File Read in all versions up to, and including, 2.0. This is due to insufficient capability checks and lack of nonce verification on the "wpag_htaccess_callback" function This makes it possible for authenticated attackers, with subscriber-level access and above, to overwrite the site's .htaccess file with arbitrary content, which can lead to arbitrary file read on the server under certain configurations.

Action-Not Available
Vendor-husainali52
Product-WP AUDIO GALLERY
CWE ID-CWE-862
Missing Authorization
CVE-2025-1279
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-0.26% / 48.86%
||
7 Day CHG~0.00%
Published-25 Apr, 2025 | 08:22
Updated-15 Apr, 2026 | 00:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
BM Content Builder <= 3.16.2.1 - Missing Authorization to Authenticated (Subscriber+) Arbitrary Options Update

The BM Content Builder plugin for WordPress is vulnerable to unauthorized modification of data that can lead to privilege escalation due to a missing capability check on the ux_cb_tools_import_item_ajax AJAX action in all versions up to, and including, 3.16.2.1. This makes it possible for authenticated attackers, with Subscriber-level access and above, to update arbitrary options on the WordPress site. This can be leveraged to update the default role for registration to administrator and enable user registration for attackers to gain administrative user access to a vulnerable site.

Action-Not Available
Vendor-SeaTheme
Product-BM Content Builder
CWE ID-CWE-862
Missing Authorization
CVE-2025-11702
Matching Score-4
Assigner-GitLab Inc.
ShareView Details
Matching Score-4
Assigner-GitLab Inc.
CVSS Score-8.5||HIGH
EPSS-0.01% / 1.90%
||
7 Day CHG~0.00%
Published-29 Oct, 2025 | 07:04
Updated-26 Feb, 2026 | 16:57
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Missing Authorization in GitLab

GitLab has remediated an issue in EE affecting all versions from 17.1 before 18.3.5, 18.4 before 18.4.3, and 18.5 before 18.5.1 that could have allowed an authenticated attacker with specific permissions to hijack project runners from other projects.

Action-Not Available
Vendor-GitLab Inc.
Product-gitlabGitLab
CWE ID-CWE-862
Missing Authorization
CVE-2025-10896
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-0.45% / 63.88%
||
7 Day CHG~0.00%
Published-04 Nov, 2025 | 04:27
Updated-08 Apr, 2026 | 17:19
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Multiple Plugins <= Multiple Versions - Missing Authorization to Authenticated (Subscriber+) Arbitrary Plugin Upload

Multiple plugins for WordPress with the Jewel Theme Recommended Plugins Library are vulnerable to Unrestricted Upload of File with Dangerous Type via arbitrary plugin installation in all versions up to, and including, 1.0.2.3. This is due to missing capability checks on the '*_recommended_upgrade_plugin' function which allows arbitrary plugin URLs to be installed. This makes it possible for authenticated attackers with subscriber-level access and above to upload arbitrary plugin packages to the affected site's server via a crafted plugin URL, which may make remote code execution possible.

Action-Not Available
Vendor-litonice13
Product-Master Blocks – Ultimate Gutenberg Blocks for MarketersContent Locker for ElementorImage Comparison Addon for ElementorImage Hover Effects for Elementor
CWE ID-CWE-862
Missing Authorization
CVE-2026-6963
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-0.02% / 5.97%
||
7 Day CHG~0.00%
Published-02 May, 2026 | 04:27
Updated-05 May, 2026 | 19:17
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WP Mail Gateway <= 1.8 - Missing Authorization to Authenticated (Subscriber+) SMTP Configuration Modification via 'wmg_save_provider_config' AJAX Action

The WP Mail Gateway plugin for WordPress is vulnerable to unauthorized access due to a missing capability check on the wmg_save_provider_config AJAX action in all versions up to, and including, 1.8. This makes it possible for authenticated attackers, with Subscriber-level access and above, to update SMTP settings and redirect mail which can be used for privilege escalation by triggering a password reset email and using that to access and administrator's account.

Action-Not Available
Vendor-shahariaazam
Product-WP Mail Gateway
CWE ID-CWE-862
Missing Authorization
CVE-2025-10299
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-0.06% / 17.79%
||
7 Day CHG-0.00%
Published-15 Oct, 2025 | 08:25
Updated-08 Apr, 2026 | 18:23
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WPBifröst – Instant Passwordless Temporary Login Links <= 1.0.7 - Missing Authorization to Authenticated (Subscriber+) Privilege Escalation

The WPBifröst – Instant Passwordless Temporary Login Links plugin for WordPress is vulnerable to Privilege Escalation due to a missing capability check on the ctl_create_link AJAX action in all versions up to, and including, 1.0.7. This makes it possible for authenticated attackers, with Subscriber-level access and above, to create new administrative user accounts and subsequently log in as those.

Action-Not Available
Vendor-hakik
Product-Bifröst – Instant Passwordless Temporary Login Links
CWE ID-CWE-862
Missing Authorization
CVE-2026-6506
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-0.04% / 12.65%
||
7 Day CHG~0.00%
Published-14 May, 2026 | 06:44
Updated-14 May, 2026 | 14:28
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
InfusedWoo Pro <= 5.1.2 - Authenticated (Subscriber+) Missing Authorization to Privilege Escalation via Arbitrary User Meta Update

The InfusedWoo Pro plugin for WordPress is vulnerable to privilege escalation in all versions up to, and including, 5.1.2. This is due to the infusedwoo_gdpr_upddata() function missing authorization and capability checks, as well as lacking restrictions on which user meta keys can be updated. This makes it possible for authenticated attackers, with subscriber-level access and above, to update their own wp_capabilities user meta to grant themselves Administrator role privileges.

Action-Not Available
Vendor-Infused Addons
Product-InfusedWoo Pro
CWE ID-CWE-862
Missing Authorization
CVE-2026-5200
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-0.04% / 11.85%
||
7 Day CHG~0.00%
Published-20 May, 2026 | 06:46
Updated-20 May, 2026 | 12:19
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
AcyMailing <= 10.8.2 - Missing Authorization to Authenticated (Subscriber+) Privilege Escalation via 'acymailing_router'

The AcyMailing – An Ultimate Newsletter Plugin and Marketing Automation Solution for WordPress plugin for WordPress is vulnerable to Missing Authorization in versions up to, and including, 10.8.2. This is due to the plugin not properly verifying that a user is authorized to perform an action. This makes it possible for authenticated attackers, with subscriber-level access and above, to modify privileged AcyMailing configuration, export subscriber secret keys, and chain these actions into administrator account takeover when a target administrator email address is known.

Action-Not Available
Vendor-AcyMailing (Altavia Jetpulp SAS, formerly ACYBA)
Product-AcyMailing – An Ultimate Newsletter Plugin and Marketing Automation Solution for WordPress
CWE ID-CWE-862
Missing Authorization
CVE-2024-9941
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-0.10% / 26.66%
||
7 Day CHG~0.00%
Published-23 Nov, 2024 | 07:38
Updated-08 Apr, 2026 | 17:23
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WPGYM <= 67.1.0 - Missing Authorization to Authenticated (Subscriber+) Privilege Escalation

The WPGYM - Wordpress Gym Management System plugin for WordPress is vulnerable to privilege escalation due to a missing capability check on the MJ_gmgt_add_staff_member() function in all versions up to, and including, 67.1.0. This makes it possible for authenticated attackers, with subscriber-level access and above, to create new user accounts with the administrator role.

Action-Not Available
Vendor-mojoomladasinfomediadasinfomedia
Product-wordpress_gym_management_systemWPGYM - Wordpress Gym Management Systemwpgym_gym_management_system
CWE ID-CWE-269
Improper Privilege Management
CWE ID-CWE-862
Missing Authorization
CVE-2024-9195
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-0.10% / 27.89%
||
7 Day CHG~0.00%
Published-28 Feb, 2025 | 08:23
Updated-08 Apr, 2026 | 17:21
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WHMPress - WHMCS Client Area <= 4.3-revision-3- Authenticated (Subscriber+) Arbitrary Options Update

The WHMPress - WHMCS Client Area plugin for WordPress is vulnerable to unauthorized modification of data that can lead to privilege escalation due to a missing capability check on the update_settings case in the /admin/ajax.php file in all versions up to, and including, 4.3-revision-3. This makes it possible for authenticated attackers, with Subscriber-level access and above, to update arbitrary options on the WordPress site. This can be leveraged to update the default role for registration to administrator and enable user registration for attackers to gain administrative user access to a vulnerable site.

Action-Not Available
Vendor-whmpresscreativeon
Product-whmcs_client_areaWHMCS Client Area for WordPress by WHMpress
CWE ID-CWE-862
Missing Authorization
CVE-2026-4484
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-0.02% / 4.69%
||
7 Day CHG-0.03%
Published-26 Mar, 2026 | 01:25
Updated-24 Apr, 2026 | 16:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Masteriyo LMS <= 2.1.6 - Missing Authorization to Authenticated (Student+) Privilege Escalation to Administrator

The Masteriyo LMS plugin for WordPress is vulnerable to Privilege Escalation in all versions up to, and including, 2.1.6. This is due to the plugin allowing a user to update the user role through the 'InstructorsController::prepare_object_for_database' function. This makes it possible for authenticated attackers, with Student-level access and above, to elevate their privileges to that of an administrator.

Action-Not Available
Vendor-masteriyo
Product-Masteriyo LMS – Online Course Builder for eLearning, LMS & Education
CWE ID-CWE-862
Missing Authorization
CVE-2024-8102
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-0.28% / 51.27%
||
7 Day CHG~0.00%
Published-04 Sep, 2024 | 06:49
Updated-08 Apr, 2026 | 17:11
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
The Ultimate WordPress Toolkit – WP Extended <= 3.0.8 - Authenticated (Subscriber+) Arbitrary Options Update

The The Ultimate WordPress Toolkit – WP Extended plugin for WordPress is vulnerable to unauthorized modification of data that can lead to privilege escalation due to a missing capability check on the module_all_toggle_ajax() function in all versions up to, and including, 3.0.8. This makes it possible for authenticated attackers, with Subscriber-level access and above, to update arbitrary options on the WordPress site. This can be leveraged to update the default role for registration to administrator and enable user registration for attackers to gain administrative user access to a vulnerable site.

Action-Not Available
Vendor-wpextendedwpextendedwpextended
Product-wp_extendedThe Ultimate WordPress Toolkit – WP Extendedwp_extended
CWE ID-CWE-862
Missing Authorization
CVE-2024-43962
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-5.4||MEDIUM
EPSS-0.21% / 43.15%
||
7 Day CHG~0.00%
Published-01 Nov, 2024 | 14:17
Updated-08 Nov, 2024 | 20:42
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress LWS Affiliation plugin <= 2.3.4 - Broken Access Control vulnerability

Missing Authorization vulnerability in LWS LWS Affiliation allows Exploiting Incorrectly Configured Access Control Security Levels.This issue affects LWS Affiliation: from n/a through 2.3.4.

Action-Not Available
Vendor-lwsLWS
Product-affiliationLWS Affiliation
CWE ID-CWE-862
Missing Authorization
CVE-2024-8114
Matching Score-4
Assigner-GitLab Inc.
ShareView Details
Matching Score-4
Assigner-GitLab Inc.
CVSS Score-8.2||HIGH
EPSS-0.25% / 48.71%
||
7 Day CHG~0.00%
Published-26 Nov, 2024 | 18:31
Updated-12 Dec, 2024 | 20:54
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Missing Authorization in GitLab

An issue has been discovered in GitLab CE/EE affecting all versions from 8.12 before 17.4.5, 17.5 before 17.5.3, and 17.6 before 17.6.1. This issue allows an attacker with access to a victim's Personal Access Token (PAT) to escalate privileges.

Action-Not Available
Vendor-GitLab Inc.
Product-gitlabGitLab
CWE ID-CWE-862
Missing Authorization
CVE-2024-4351
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-31.04% / 96.81%
||
7 Day CHG~0.00%
Published-16 May, 2024 | 09:32
Updated-08 Apr, 2026 | 18:21
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Tutor LMS Pro <= 2.7.0 - Missing Authorization to Privilege Escalation

The Tutor LMS Pro plugin for WordPress is vulnerable to unauthorized access of data, modification of data, loss of data due to a missing capability check on the 'authenticate' function in all versions up to, and including, 2.7.0. This makes it possible for authenticated attackers, with subscriber-level permissions and above, to gain control of an existing administrator account.

Action-Not Available
Vendor-Themeum
Product-tutor_lmsTutor LMS Protutor_lms
CWE ID-CWE-862
Missing Authorization
CWE ID-CWE-89
Improper Neutralization of Special Elements used in an SQL Command ('SQL Injection')
CVE-2022-4935
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-0.22% / 45.14%
||
7 Day CHG+0.01%
Published-05 Apr, 2023 | 17:27
Updated-08 Apr, 2026 | 18:17
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WCFM Marketplace <= 3.4.11 - Missing Authorization

The WCFM Marketplace plugin for WordPress is vulnerable to unauthorized modification and access of data in versions up to, and including, 3.4.11 due to missing capability checks on various AJAX actions. This makes it possible for authenticated attackers, with minimal permissions such as subscribers, to perform a wide variety of actions such as modifying shipping method details, modifying products, deleting arbitrary posts, and privilege escalation (via the wp_ajax_wcfm_vendor_store_online AJAX action).

Action-Not Available
Vendor-wcloverswclovers
Product-wcfm_marketplaceWCFM Marketplace – Multivendor Marketplace for WooCommerce
CWE ID-CWE-862
Missing Authorization
CWE ID-CWE-89
Improper Neutralization of Special Elements used in an SQL Command ('SQL Injection')
CVE-2022-4950
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-5.42% / 90.24%
||
7 Day CHG~0.00%
Published-07 Jun, 2023 | 01:51
Updated-08 Apr, 2026 | 19:17
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Cool Plugins (Various Versions) - Arbitrary Plugin Installation and Activation

Several WordPress plugins developed by Cool Plugins are vulnerable to arbitrary plugin installation and activation that can lead to remote code execution by authenticated attackers with minimal permissions, such as a subscriber.

Action-Not Available
Vendor-cryptocurrency_payment_\&_donation_box_pluginscoolpluginsblackworks1coolpluginsnarinder-singh
Product-events_search_for_the_events_calendarevents_widgets_for_elementor_and_the_events_calendarthe_events_calendar_countdown_addonevents_shortcodes_for_the_events_calendarevent_single_page_builder_for_the_event_calendarevents-notification-bar-addoncryptocurrency_widgets_for_elementorcryptocurrency_payment_\&_donation_boxcryptocurrency_widgetscool_timelineCryptocurrency Donation Box – Bitcoin & Crypto DonationsEvent Single Page Builder For The Events CalendarThe Events Calendar Events Notification Bar AddonEvents Shortcodes For The Events CalendarCryptocurrency Widgets – Price Ticker & Coins ListCryptocurrency Widgets For ElementorEvents Widgets For Elementor And The Events CalendarCool Timeline (Horizontal & Vertical Timeline)Events Search For The Events CalendarEvent Countdown for The Events Calendar
CWE ID-CWE-862
Missing Authorization
CVE-2024-6698
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-0.32% / 55.51%
||
7 Day CHG~0.00%
Published-01 Aug, 2024 | 03:29
Updated-08 Apr, 2026 | 16:44
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
FundEngine – Donation and Crowdfunding Platform <= 1.7.0 - Authenticated (Subscriber+) Privilege Escalation

The FundEngine plugin for WordPress is vulnerable to privilege escalation in all versions up to, and including, 1.7.0. This is due to the plugin not properly verifying user meta updated through the update_user_meta function. This makes it possible for authenticated attackers, with subscriber-level access and above, to update their user meta which can be leveraged to update their capabilities to gain administrator access.

Action-Not Available
Vendor-wpmetroxnorwpmet
Product-fundengineFundEngine – Donation and Crowdfunding Platformwp_fundraising_donation_and_crowdfunding_platform
CWE ID-CWE-862
Missing Authorization
CVE-2024-43296
Matching Score-4
Assigner-Patchstack
ShareView Details
Matching Score-4
Assigner-Patchstack
CVSS Score-4.3||MEDIUM
EPSS-0.29% / 52.45%
||
7 Day CHG~0.00%
Published-01 Nov, 2024 | 14:17
Updated-28 Apr, 2026 | 16:10
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
WordPress HTML5 Video Player plugin <= 2.5.30 - Broken Access Control vulnerability

Missing Authorization vulnerability in bPlugins LLC Flash & HTML5 Video allows Exploiting Incorrectly Configured Access Control Security Levels.This issue affects Flash & HTML5 Video: from n/a through 2.5.30.

Action-Not Available
Vendor-bpluginsbPlugins LLC
Product-html5_video_playerFlash & HTML5 Video
CWE ID-CWE-862
Missing Authorization
CVE-2015-10140
Matching Score-4
Assigner-WPScan
ShareView Details
Matching Score-4
Assigner-WPScan
CVSS Score-8.8||HIGH
EPSS-73.87% / 98.84%
||
7 Day CHG+16.77%
Published-22 Jul, 2025 | 13:20
Updated-09 Jan, 2026 | 21:16
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Ajax Load More < 2.8.1.2 - Subscriber+ File Upload & Deletion

The Ajax Load More plugin before 2.8.1.2 does not have authorisation in some of its AJAX actions, allowing any authenticated users, such as subscriber, to upload and delete arbitrary files.

Action-Not Available
Vendor-connekthqUnknown
Product-ajax_load_moreAjax Load More
CWE ID-CWE-862
Missing Authorization
CVE-2024-6303
Matching Score-4
Assigner-GitLab Inc.
ShareView Details
Matching Score-4
Assigner-GitLab Inc.
CVSS Score-9.9||CRITICAL
EPSS-0.27% / 50.76%
||
7 Day CHG~0.00%
Published-25 Jun, 2024 | 13:02
Updated-20 Sep, 2024 | 18:34
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Missing Authorization in Conduit

Missing authorization in Client-Server API in Conduit <=0.7.0, allowing for any alias to be removed and added to another room, which can be used for privilege escalation by moving the #admins alias to a room which they control, allowing them to run commands resetting passwords, siging json with the server's key, deactivating users, and more

Action-Not Available
Vendor-conduitThe Conduit Contributors
Product-conduitConduit
CWE ID-CWE-862
Missing Authorization
CVE-2026-4261
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-0.05% / 15.77%
||
7 Day CHG~0.00%
Published-21 Mar, 2026 | 03:27
Updated-24 Apr, 2026 | 16:27
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Expire Users <= 1.2.2 - Authenticated (Subscriber+) Privilege Escalation to Administrator via save_extra_user_profile_fields

The Expire Users plugin for WordPress is vulnerable to Privilege Escalation in all versions up to, and including, 1.2.2. This is due to the plugin allowing a user to update the 'on_expire_default_to_role' meta through the 'save_extra_user_profile_fields' function. This makes it possible for authenticated attackers, with Subscriber-level access and above, to elevate their privileges to that of an administrator.

Action-Not Available
Vendor-husobj
Product-Expire Users
CWE ID-CWE-862
Missing Authorization
CVE-2024-6069
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-8.8||HIGH
EPSS-1.85% / 83.23%
||
7 Day CHG~0.00%
Published-09 Jul, 2024 | 08:33
Updated-15 Apr, 2026 | 00:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Pie Register - Basic <= 3.8.3.4 - Missing Authorization to Authenticated (Subscriber+) Arbitrary Plugin Installation

The Registration Forms – User Registration Forms, Invitation-Based Registrations, Front-end User Profile, Login Form & Content Restriction plugin for WordPress is vulnerable to unauthorized arbitrary plugin installation due to a missing capability check on the pieregister_install_addon function in all versions up to, and including, 3.8.3.4. This makes it possible for authenticated attackers, with subscriber-level access and above, to install arbitrary plugins. As a result attackers might achieve code execution on the targeted server

Action-Not Available
Vendor-genetechproductsgenetech_products
Product-Pie Register – User Registration, Profiles & Content Restrictionuser_registration_formscontent_registrationregistration_formsfront_end_user_profile_login_forminvitation_based_registrations
CWE ID-CWE-862
Missing Authorization
CVE-2026-41349
Matching Score-4
Assigner-VulnCheck
ShareView Details
Matching Score-4
Assigner-VulnCheck
CVSS Score-8.7||HIGH
EPSS-0.12% / 30.14%
||
7 Day CHG~0.00%
Published-23 Apr, 2026 | 21:58
Updated-29 Apr, 2026 | 14:40
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
OpenClaw < 2026.3.28 - Agentic Consent Bypass via config.patch

OpenClaw before 2026.3.28 contains an agentic consent bypass vulnerability allowing LLM agents to silently disable execution approval via config.patch parameter. Remote attackers can exploit this to bypass security controls and execute unauthorized operations without user consent.

Action-Not Available
Vendor-OpenClaw
Product-openclawOpenClaw
CWE ID-CWE-862
Missing Authorization
  • Previous
  • 1
  • 2
  • 3
  • ...
  • 10
  • 11
  • Next
Details not found