Logo
-

Byte Open Security

(ByteOS Network)

Log In

Sign Up

ByteOS

Security
Vulnerability Details
Registries
Custom Views
Weaknesses
Attack Patterns
Filters & Tools
Vulnerability Details :

CVE-2025-24970

Summary
Assigner-GitHub_M
Assigner Org ID-a0819718-46f1-4df5-94e2-005712e83aaa
Published At-10 Feb, 2025 | 21:57
Updated At-16 Apr, 2025 | 15:37
Rejected At-
Credits

SslHandler doesn't correctly validate packets which can lead to native crash when using native SSLEngine

Netty, an asynchronous, event-driven network application framework, has a vulnerability starting in version 4.1.91.Final and prior to version 4.1.118.Final. When a special crafted packet is received via SslHandler it doesn't correctly handle validation of such a packet in all cases which can lead to a native crash. Version 4.1.118.Final contains a patch. As workaround its possible to either disable the usage of the native SSLEngine or change the code manually.

Vendors
-
Not available
Products
-
Metrics (CVSS)
VersionBase scoreBase severityVector
Weaknesses
Attack Patterns
Solution/Workaround
References
HyperlinkResource Type
EPSS History
Score
Latest Score
-
N/A
No data available for selected date range
Percentile
Latest Percentile
-
N/A
No data available for selected date range
Stakeholder-Specific Vulnerability Categorization (SSVC)
▼Common Vulnerabilities and Exposures (CVE)
cve.org
Assigner:GitHub_M
Assigner Org ID:a0819718-46f1-4df5-94e2-005712e83aaa
Published At:10 Feb, 2025 | 21:57
Updated At:16 Apr, 2025 | 15:37
Rejected At:
▼CVE Numbering Authority (CNA)
SslHandler doesn't correctly validate packets which can lead to native crash when using native SSLEngine

Netty, an asynchronous, event-driven network application framework, has a vulnerability starting in version 4.1.91.Final and prior to version 4.1.118.Final. When a special crafted packet is received via SslHandler it doesn't correctly handle validation of such a packet in all cases which can lead to a native crash. Version 4.1.118.Final contains a patch. As workaround its possible to either disable the usage of the native SSLEngine or change the code manually.

Affected Products
Vendor
The Netty Projectnetty
Product
netty
Versions
Affected
  • >= 4.1.91.Final, <= 4.1.117.Final
Problem Types
TypeCWE IDDescription
CWECWE-20CWE-20: Improper Input Validation
Type: CWE
CWE ID: CWE-20
Description: CWE-20: Improper Input Validation
Metrics
VersionBase scoreBase severityVector
3.17.5HIGH
CVSS:3.1/AV:N/AC:L/PR:N/UI:N/S:U/C:N/I:N/A:H
Version: 3.1
Base score: 7.5
Base severity: HIGH
Vector:
CVSS:3.1/AV:N/AC:L/PR:N/UI:N/S:U/C:N/I:N/A:H
Metrics Other Info
Impacts
CAPEC IDDescription
Solutions

Configurations

Workarounds

Exploits

Credits

Timeline
EventDate
Replaced By

Rejected Reason

References
HyperlinkResource
https://github.com/netty/netty/security/advisories/GHSA-4g8c-wm8x-jfhw
x_refsource_CONFIRM
https://github.com/netty/netty/commit/87f40725155b2f89adfde68c7732f97c153676c4
x_refsource_MISC
Hyperlink: https://github.com/netty/netty/security/advisories/GHSA-4g8c-wm8x-jfhw
Resource:
x_refsource_CONFIRM
Hyperlink: https://github.com/netty/netty/commit/87f40725155b2f89adfde68c7732f97c153676c4
Resource:
x_refsource_MISC
▼Authorized Data Publishers (ADP)
1. CISA ADP Vulnrichment
Affected Products
Metrics
VersionBase scoreBase severityVector
Metrics Other Info
Impacts
CAPEC IDDescription
Solutions

Configurations

Workarounds

Exploits

Credits

Timeline
EventDate
Replaced By

Rejected Reason

References
HyperlinkResource
https://github.com/netty/netty/security/advisories/GHSA-4g8c-wm8x-jfhw
exploit
Hyperlink: https://github.com/netty/netty/security/advisories/GHSA-4g8c-wm8x-jfhw
Resource:
exploit
2. CVE Program Container
Affected Products
Metrics
VersionBase scoreBase severityVector
Metrics Other Info
Impacts
CAPEC IDDescription
Solutions

Configurations

Workarounds

Exploits

Credits

Timeline
EventDate
Replaced By

Rejected Reason

References
HyperlinkResource
https://security.netapp.com/advisory/ntap-20250221-0005/
N/A
https://www.vicarius.io/vsociety/posts/cve-2025-24970-netty-vulnerability-detection
N/A
https://www.vicarius.io/vsociety/posts/cve-2025-24970-netty-vulnerability-mitigation
N/A
Hyperlink: https://security.netapp.com/advisory/ntap-20250221-0005/
Resource: N/A
Hyperlink: https://www.vicarius.io/vsociety/posts/cve-2025-24970-netty-vulnerability-detection
Resource: N/A
Hyperlink: https://www.vicarius.io/vsociety/posts/cve-2025-24970-netty-vulnerability-mitigation
Resource: N/A
Information is not available yet
▼National Vulnerability Database (NVD)
nvd.nist.gov
Source:security-advisories@github.com
Published At:10 Feb, 2025 | 22:15
Updated At:16 Apr, 2025 | 16:15

Netty, an asynchronous, event-driven network application framework, has a vulnerability starting in version 4.1.91.Final and prior to version 4.1.118.Final. When a special crafted packet is received via SslHandler it doesn't correctly handle validation of such a packet in all cases which can lead to a native crash. Version 4.1.118.Final contains a patch. As workaround its possible to either disable the usage of the native SSLEngine or change the code manually.

CISA Catalog
Date AddedDue DateVulnerability NameRequired Action
N/A
Date Added: N/A
Due Date: N/A
Vulnerability Name: N/A
Required Action: N/A
Metrics
TypeVersionBase scoreBase severityVector
Secondary3.17.5HIGH
CVSS:3.1/AV:N/AC:L/PR:N/UI:N/S:U/C:N/I:N/A:H
Type: Secondary
Version: 3.1
Base score: 7.5
Base severity: HIGH
Vector:
CVSS:3.1/AV:N/AC:L/PR:N/UI:N/S:U/C:N/I:N/A:H
CPE Matches

Weaknesses
CWE IDTypeSource
CWE-20Secondarysecurity-advisories@github.com
CWE ID: CWE-20
Type: Secondary
Source: security-advisories@github.com
Evaluator Description

Evaluator Impact

Evaluator Solution

Vendor Statements

References
HyperlinkSourceResource
https://github.com/netty/netty/commit/87f40725155b2f89adfde68c7732f97c153676c4security-advisories@github.com
N/A
https://github.com/netty/netty/security/advisories/GHSA-4g8c-wm8x-jfhwsecurity-advisories@github.com
N/A
https://security.netapp.com/advisory/ntap-20250221-0005/af854a3a-2127-422b-91ae-364da2661108
N/A
https://www.vicarius.io/vsociety/posts/cve-2025-24970-netty-vulnerability-detectionaf854a3a-2127-422b-91ae-364da2661108
N/A
https://www.vicarius.io/vsociety/posts/cve-2025-24970-netty-vulnerability-mitigationaf854a3a-2127-422b-91ae-364da2661108
N/A
https://github.com/netty/netty/security/advisories/GHSA-4g8c-wm8x-jfhw134c704f-9b21-4f2e-91b3-4a467353bcc0
N/A
Hyperlink: https://github.com/netty/netty/commit/87f40725155b2f89adfde68c7732f97c153676c4
Source: security-advisories@github.com
Resource: N/A
Hyperlink: https://github.com/netty/netty/security/advisories/GHSA-4g8c-wm8x-jfhw
Source: security-advisories@github.com
Resource: N/A
Hyperlink: https://security.netapp.com/advisory/ntap-20250221-0005/
Source: af854a3a-2127-422b-91ae-364da2661108
Resource: N/A
Hyperlink: https://www.vicarius.io/vsociety/posts/cve-2025-24970-netty-vulnerability-detection
Source: af854a3a-2127-422b-91ae-364da2661108
Resource: N/A
Hyperlink: https://www.vicarius.io/vsociety/posts/cve-2025-24970-netty-vulnerability-mitigation
Source: af854a3a-2127-422b-91ae-364da2661108
Resource: N/A
Hyperlink: https://github.com/netty/netty/security/advisories/GHSA-4g8c-wm8x-jfhw
Source: 134c704f-9b21-4f2e-91b3-4a467353bcc0
Resource: N/A

Change History

0
Information is not available yet

Similar CVEs

784Records found

CVE-2026-44892
Matching Score-8
Assigner-GitHub, Inc.
ShareView Details
Matching Score-8
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-Not Assigned
Published-12 Jun, 2026 | 05:04
Updated-12 Jun, 2026 | 09:59
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty has a Vulnerable Default Configuration Which Leads to Denial of Service via Unbounded HTTP/3 Header Size

Netty is a network application framework for development of protocol servers and clients. Prior to version 4.2.15.Final, the default configuration of the `Http3ConnectionHandler` in the Netty HTTP/3 codec lacks an enforced maximum header size limit. When a peer does not explicitly specify `HTTP3_SETTINGS_MAX_FIELD_SECTION_SIZE`, the implementation defaults to an unbounded limit. This insecure default configuration allows a malicious client or server to send an enormous number of headers, leading to a memory exhaustion Denial of Service via an `OutOfMemoryError`. Version 4.2.15.Final contains a patch.

Action-Not Available
Vendor-The Netty Project
Product-netty
CWE ID-CWE-1188
Initialization of a Resource with an Insecure Default
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2026-45416
Matching Score-8
Assigner-GitHub, Inc.
ShareView Details
Matching Score-8
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-Not Assigned
Published-12 Jun, 2026 | 14:10
Updated-12 Jun, 2026 | 15:55
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty: SNI handler pre-allocates up to 16 MiB from nine attacker bytes

Netty is a network application framework for development of protocol servers and clients. Prior to versions 4.1.135.Final and 4.2.15.Final, SslClientHelloHandler.decode() reads the 24-bit TLS handshake length and, when the ClientHello does not fit in the first record, eagerly allocates `ctx.alloc().buffer(handshakeLength)` (line 161). The guard at line 140 is `handshakeLength > maxClientHelloLength && maxClientHelloLength != 0`, and the commonly-used SniHandler/AbstractSniHandler constructors (SniHandler(Mapping), SniHandler(AsyncMapping), AbstractSniHandler()) pass maxClientHelloLength=0 and handshakeTimeoutMillis=0, so the length guard is disabled and no timeout is scheduled. A 16 MiB request exceeds the default pooled chunk size and becomes a huge/unpooled allocation performed immediately. The buffer is retained in the handler until the channel closes. Versions 4.1.135.Final and 4.2.15.Final patch the issue.

Action-Not Available
Vendor-The Netty Project
Product-netty
CWE ID-CWE-770
Allocation of Resources Without Limits or Throttling
CVE-2026-48748
Matching Score-8
Assigner-GitHub, Inc.
ShareView Details
Matching Score-8
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-Not Assigned
Published-12 Jun, 2026 | 14:45
Updated-12 Jun, 2026 | 16:18
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty HTTP/3 QPACK Blocked Streams Memory Exhaustion

Netty is a network application framework for development of protocol servers and clients. Prior to version 4.2.15.Final, a memory exhaustion vulnerability in the Netty HTTP/3 codec allows the creation of an infinite number of blocked streams, which can cause OOM error. Version 4.2.15.Final patches the issue.

Action-Not Available
Vendor-The Netty Project
Product-netty
CWE ID-CWE-770
Allocation of Resources Without Limits or Throttling
CVE-2026-46340
Matching Score-8
Assigner-GitHub, Inc.
ShareView Details
Matching Score-8
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-Not Assigned
Published-12 Jun, 2026 | 14:19
Updated-12 Jun, 2026 | 16:31
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty: SCTP reassembly nests buffers without bound

Netty is a network application framework for development of protocol servers and clients. In versions of netty-transport-sctp prior to 4.1.135.Final and 4.2.15.Final, for each non-complete SctpMessage fragment the handler does `fragments.put(streamId, Unpooled.wrappedBuffer(frag, byteBuf))`, wrapping the previous accumulator and the new slice into a *new* CompositeByteBuf every time. After N fragments the accumulator is an N-deep chain of composites, each holding references and component arrays; readableBytes()/getBytes() on the final buffer recurse N levels. There is no limit on N, on total bytes, or on the number of streamIdentifiers an attacker can open (each gets its own map entry). A peer that never sets the `complete` flag can grow this structure indefinitely from tiny 1-byte DATA chunks. Versions 4.1.135.Final and 4.2.15.Final patch the issue.

Action-Not Available
Vendor-The Netty Project
Product-netty
CWE ID-CWE-770
Allocation of Resources Without Limits or Throttling
CVE-2026-50011
Matching Score-8
Assigner-GitHub, Inc.
ShareView Details
Matching Score-8
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-Not Assigned
Published-12 Jun, 2026 | 14:52
Updated-12 Jun, 2026 | 16:18
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty has unbounded pre-allocation in RedisArrayAggregator from RESP array length

Netty is a network application framework for development of protocol servers and clients. Prior to versions 4.1.135.Final and 4.2.15.Final, RedisArrayAggregator pre-allocates ArrayList with initial capacity equal to the RESP array element count declared in an array header. That count is taken from the wire before the corresponding child messages exist. A small malicious header can claim a huge initial capacity. Versions 4.1.135.Final and 4.2.15.Final patch the issue.

Action-Not Available
Vendor-The Netty Project
Product-netty
CWE ID-CWE-400
Uncontrolled Resource Consumption
CWE ID-CWE-770
Allocation of Resources Without Limits or Throttling
CVE-2026-44893
Matching Score-8
Assigner-GitHub, Inc.
ShareView Details
Matching Score-8
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-Not Assigned
Published-12 Jun, 2026 | 14:00
Updated-12 Jun, 2026 | 19:02
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty: HAProxy SSL TLV parsing leaks retained slice on invalid TLV length

Netty is a network application framework for development of protocol servers and clients. In netty-codec-haproxy prior to versions 4.1.135.Final and 4.2.15.Final, when decoding a PP2_TYPE_SSL TLV, HAProxyMessage.readNextTLV() first calls `header.retainedSlice(header.readerIndex(), length)` and only then reads the 1-byte client field and 4-byte verify field. If the attacker sets the TLV length below 5, the subsequent readByte/readInt throws IndexOutOfBoundsException. HAProxyMessageDecoder only catches HAProxyProtocolException around this call, so the IOOBE propagates and the retained slice on the pooled cumulation buffer is never released. Versions 4.1.135.Final and 4.2.15.Final patch the issue.

Action-Not Available
Vendor-The Netty Project
Product-netty
CWE ID-CWE-703
Improper Check or Handling of Exceptional Conditions
CVE-2025-55163
Matching Score-8
Assigner-GitHub, Inc.
ShareView Details
Matching Score-8
Assigner-GitHub, Inc.
CVSS Score-8.2||HIGH
EPSS-0.12% / 30.88%
||
7 Day CHG+0.07%
Published-13 Aug, 2025 | 14:17
Updated-04 Nov, 2025 | 22:16
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty MadeYouReset HTTP/2 DDoS Vulnerability

Netty is an asynchronous, event-driven network application framework. Prior to versions 4.1.124.Final and 4.2.4.Final, Netty is vulnerable to MadeYouReset DDoS. This is a logical vulnerability in the HTTP/2 protocol, that uses malformed HTTP/2 control frames in order to break the max concurrent streams limit - which results in resource exhaustion and distributed denial of service. This issue has been patched in versions 4.1.124.Final and 4.2.4.Final.

Action-Not Available
Vendor-The Netty Project
Product-nettynetty
CWE ID-CWE-770
Allocation of Resources Without Limits or Throttling
CVE-2020-11612
Matching Score-8
Assigner-MITRE Corporation
ShareView Details
Matching Score-8
Assigner-MITRE Corporation
CVSS Score-7.5||HIGH
EPSS-4.33% / 89.15%
||
7 Day CHG~0.00%
Published-07 Apr, 2020 | 18:00
Updated-04 Aug, 2024 | 11:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

The ZlibDecoders in Netty 4.1.x before 4.1.46 allow for unbounded memory allocation while decoding a ZlibEncoded byte stream. An attacker could send a large ZlibEncoded byte stream to the Netty server, forcing the server to allocate all of its free memory to a single decoder.

Action-Not Available
Vendor-n/aThe Netty ProjectNetApp, Inc.Debian GNU/LinuxFedora ProjectOracle Corporation
Product-communications_cloud_native_core_service_communication_proxysiebel_core_-_server_frameworkdebian_linuxoncommand_api_servicescommunications_messaging_servernettynosql_databasecommunications_design_studiofedoraoncommand_workflow_automationcommunications_brm_-_elastic_charging_enginewebcenter_portaloncommand_insightn/a
CWE ID-CWE-770
Allocation of Resources Without Limits or Throttling
CVE-2026-44250
Matching Score-8
Assigner-GitHub, Inc.
ShareView Details
Matching Score-8
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-Not Assigned
Published-11 Jun, 2026 | 20:49
Updated-12 Jun, 2026 | 13:44
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty: Memory Exhaustion in RedisArrayAggregator due to Deeply Nested Arrays

Netty is a network application framework for development of protocol servers and clients. In netty-codec-redis prior to versions 4.1.135.Final and 4.2.15.Final, an attacker can cause DoS by sending a crafted Redis payload with deeply nested arrays. This forces the server to allocate a massive number of state objects and collections, leading to memory exhaustion and an OutOfMemoryError. Versions 4.1.135.Final and 4.2.15.Final patch the issue.

Action-Not Available
Vendor-The Netty Project
Product-netty
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2026-44890
Matching Score-8
Assigner-GitHub, Inc.
ShareView Details
Matching Score-8
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-Not Assigned
Published-11 Jun, 2026 | 20:52
Updated-12 Jun, 2026 | 10:05
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty has Unbounded Direct Memory Consumption in its RedisDecoder

Netty is a network application framework for development of protocol servers and clients. In netty-codec-redis prior to versions 4.1.135.Final and 4.2.15.Final, an attacker can cause DoS by sending crafted Redis payloads across multiple connections without `\r\n`. This exhausts the server's direct memory pool (OutOfDirectMemoryError), preventing legitimate connections from being processed. Versions 4.1.135.Final and 4.2.15.Final patch the issue.

Action-Not Available
Vendor-The Netty Project
Product-netty
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2026-44248
Matching Score-8
Assigner-GitHub, Inc.
ShareView Details
Matching Score-8
Assigner-GitHub, Inc.
CVSS Score-5.3||MEDIUM
EPSS-0.02% / 4.85%
||
7 Day CHG~0.00%
Published-13 May, 2026 | 18:23
Updated-18 May, 2026 | 12:15
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty: Resource exhaustion in MqttDecoder

Netty is an asynchronous, event-driven network application framework. Prior to 4.2.13.Final and 4.1.133.Final, the MQTT 5 header Properties section is parsed and buffered before any message size limit is applied. Specifically, in MqttDecoder, the decodeVariableHeader() method is called before the bytesRemainingBeforeVariableHeader > maxBytesInMessage check. The decodeVariableHeader() can call other methods which will call decodeProperties(). Effectively, Netty does not apply any limits to the size of the properties being decoded. Additionally, because MqttDecoder extends ReplayingDecoder, Netty will repeatedly re-parse the enormous Properties sections and buffer the bytes in memory, until the entire thing parses to completion. This can cause high resource usage in both CPU and memory. This vulnerability is fixed in 4.2.13.Final and 4.1.133.Final.

Action-Not Available
Vendor-io.nettyThe Netty Project
Product-nettynetty-codec-mqttnetty
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2026-42583
Matching Score-8
Assigner-GitHub, Inc.
ShareView Details
Matching Score-8
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-0.02% / 4.32%
||
7 Day CHG~0.00%
Published-13 May, 2026 | 18:09
Updated-18 May, 2026 | 12:22
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty: Lz4FrameDecoder resource exhaustion

Netty is an asynchronous, event-driven network application framework. Prior to 4.2.13.Final and 4.1.133.Final, Lz4FrameDecoder allocates a ByteBuf of size decompressedLength (up to 32 MB per block) before LZ4 runs. A peer only needs a 21-byte header plus compressedLength payload bytes - 22 bytes if compressedLength == 1 - to force that allocation. This vulnerability is fixed in 4.2.13.Final and 4.1.133.Final.

Action-Not Available
Vendor-io.nettyThe Netty Project
Product-nettynetty-codec-compressionnettynetty-codec
CWE ID-CWE-400
Uncontrolled Resource Consumption
CWE ID-CWE-770
Allocation of Resources Without Limits or Throttling
CVE-2026-42577
Matching Score-8
Assigner-GitHub, Inc.
ShareView Details
Matching Score-8
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-0.05% / 16.46%
||
7 Day CHG~0.00%
Published-13 May, 2026 | 18:00
Updated-18 May, 2026 | 14:05
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty: epoll transport denial of service via RST on half-closed TCP connection

Netty is an asynchronous, event-driven network application framework. From 4.2.0.Final to 4.2.13.Final , Netty's epoll transport fails to detect and close TCP connections that receive a RST after being half-closed, leading to stale channels that are never cleaned up and, in some code paths, a 100% CPU busy-loop in the event loop thread. This vulnerability is fixed in 4.2.13.Final.

Action-Not Available
Vendor-The Netty Project
Product-nettynetty
CWE ID-CWE-772
Missing Release of Resource after Effective Lifetime
CVE-2026-42587
Matching Score-8
Assigner-GitHub, Inc.
ShareView Details
Matching Score-8
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-0.02% / 4.78%
||
7 Day CHG~0.00%
Published-13 May, 2026 | 18:22
Updated-18 May, 2026 | 12:20
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty: HttpContentDecompressor maxAllocation bypass via Content-Encoding: br/zstd/snappy enables decompression bomb DoS

Netty is an asynchronous, event-driven network application framework. Prior to 4.2.13.Final and 4.1.133.Final, HttpContentDecompressor accepts a maxAllocation parameter to limit decompression buffer size and prevent decompression bomb attacks. This limit is correctly enforced for gzip and deflate encodings via ZlibDecoder, but is silently ignored when the content encoding is br (Brotli), zstd, or snappy. An attacker can bypass the configured decompression limit by sending a compressed payload with Content-Encoding: br instead of Content-Encoding: gzip, causing unbounded memory allocation and out-of-memory denial of service. The same vulnerability exists in DelegatingDecompressorFrameListener for HTTP/2 connections. This vulnerability is fixed in 4.2.13.Final and 4.1.133.Final.

Action-Not Available
Vendor-io.nettyThe Netty Project
Product-nettynetty-codec-httpnettynetty-codec-http2
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2026-33871
Matching Score-8
Assigner-GitHub, Inc.
ShareView Details
Matching Score-8
Assigner-GitHub, Inc.
CVSS Score-8.7||HIGH
EPSS-0.04% / 11.77%
||
7 Day CHG~0.00%
Published-27 Mar, 2026 | 19:55
Updated-31 Mar, 2026 | 18:54
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty HTTP/2 CONTINUATION Frame Flood DoS via Zero-Byte Frame Bypass

Netty is an asynchronous, event-driven network application framework. In versions prior to 4.1.132.Final and 4.2.10.Final, a remote user can trigger a Denial of Service (DoS) against a Netty HTTP/2 server by sending a flood of `CONTINUATION` frames. The server's lack of a limit on the number of `CONTINUATION` frames, combined with a bypass of existing size-based mitigations using zero-byte frames, allows an user to cause excessive CPU consumption with minimal bandwidth, rendering the server unresponsive. Versions 4.1.132.Final and 4.2.10.Final fix the issue.

Action-Not Available
Vendor-The Netty Project
Product-nettynetty
CWE ID-CWE-770
Allocation of Resources Without Limits or Throttling
CVE-2023-44487
Matching Score-8
Assigner-MITRE Corporation
ShareView Details
Matching Score-8
Assigner-MITRE Corporation
CVSS Score-7.5||HIGH
EPSS-94.39% / 99.97%
||
7 Day CHG-0.01%
Published-10 Oct, 2023 | 00:00
Updated-12 May, 2026 | 15:10
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Known KEV||Action Due Date - 2023-10-31||Apply mitigations per vendor instructions, follow applicable BOD 22-01 guidance for cloud services, or discontinue use of the product if mitigations are unavailable.

The HTTP/2 protocol allows a denial of service (server resource consumption) because request cancellation can reset many streams quickly, as exploited in the wild in August through October 2023.

Action-Not Available
Vendor-varnish_cache_projectamazonlinkerdakkatraefikcaddyserverprojectcontourdenagrpcistioenvoyproxykonghqlinecorpkazu-yamamotonghttp2openrestyn/aRed Hat, Inc.NetApp, Inc.Siemens AGGoF5, Inc.The Netty ProjectThe Apache Software FoundationMicrosoft CorporationApple Inc.Eclipse Foundation AISBLCisco Systems, Inc.Fedora ProjectDebian GNU/LinuxThe IETF Administration LLC (IETF LLC)FacebookNode.js (OpenJS Foundation)Jenkins
Product-nexus_9804nexus_9332d-h2rnexus_9372txnexus_9200istionexus_92160yc_switchfedoranexus_92160yc-xsiplus_s7-1500_cpu_1518-4_pn\/dp_mfp_firmwareenterprise_chat_and_email.netvisual_studio_2022windows_10_22h2node_healthcheck_operatornexus_36180yc-ropenshift_sandboxed_containersnexus_9500_4-slotnexus_93128tx_switchnexus_92300ycbig-ip_nextcost_managementjboss_enterprise_application_platformnexus_9200ycnexus_9332pqnexus_9396txproxygenultra_cloud_core_-_session_management_functionintegration_camel_kintegration_camel_for_spring_bootnexus_3064tazure_kubernetes_servicenexus_93180yc-fxcrosswork_zero_touch_provisioningbig-ip_analyticsnexus_3432d-snexus_93180yc-fx3secure_malware_analyticsopensearch_data_preppersecure_web_appliance_firmwareweb_terminalprime_infrastructurenexus_93180lc-ex_switchopenshift_container_platform_assisted_installercertification_for_red_hat_enterprise_linuxprime_cable_provisioningnexus_93108tc-fx-24connected_mobile_experiencesnexus_92300yc_switchprocess_automationexpresswayhttp_serverunified_attendant_console_advancedopenstack_platformnginx_plusnexus_93240yc-fx2nexus_3636c-rcryostatnexus_3100-zsingle_sign-onopenshift_distributed_tracingnexus_9736pqnexus_9272qnexus_3016qnexus_93108tc-ex-24unified_contact_center_domain_managernexus_9396tx_switchopenshift_developer_tools_and_servicesnexus_93128crosswork_situation_managernexus_93180yc-ex-24nexus_9332pq_switchwindows_server_2022nexus_31108pc-vopenshift_api_for_data_protectionopenshift_gitopsnexus_3132c-zsupport_for_spring_bootwindows_server_2016nexus_3016nexus_3132q-vopenshift_service_mesh3scale_api_management_platformnexus_3464cnexus_9500ropenshiftcaddynexus_3100-vnexus_3132qopenshift_secondary_scheduler_operatornexus_3064-32tnexus_31108tc-varmeriagomigration_toolkit_for_containersbuild_of_optaplannernexus_3232nexus_9372pxbig-ip_websafenexus_9500_supervisor_anexus_9348gc-fxpultra_cloud_core_-_serving_gateway_functionnexus_3172tqnexus_9504windows_10_21h2nexus_3064xnexus_3232cnexus_9636pqnexus_3400jettyansible_automation_platformnexus_9500_supervisor_bnexus_9372tx-ewindows_10_1809nexus_3524-xlnexus_3408-snexus_3172tq-32tnexus_93180tc-exnexus_9516nexus_3524-xnexus_3264c-enexus_3172pqnexus_3172pq\/pq-xlnexus_9336pqastra_control_centernexus_9364c-gxnexus_9336c-fx2simatic_s7-1500_cpu_1518-4_pn\/dpnexus_9236cnexus_9536pqnexus_9236c_switchnexus_93180yc-fx-24nexus_31128pqnetwork_observability_operatorbig-ip_application_security_managerprime_access_registrarswiftnio_http\/2linkerdios_xewindows_11_22h2nexus_9500_supervisor_b\+nexus_9364d-gx2adecision_managerbig-ip_policy_enforcement_managerquaynexus_3264qbusiness_process_automationnexus_3100vsecure_dynamic_attributes_connectornexus_9372tx_switchnexus_9500_supervisor_a\+machine_deletion_remediation_operatornode.jssatellitenexus_9348d-gx2abig-ip_domain_name_systemnexus_3064nexus_9372px-e_switchbig-ip_link_controllernexus_93108tc-ex_switchhttpbig-ip_advanced_firewall_managerprime_network_registrarcert-manager_operator_for_red_hat_openshiftnexus_9432pqtraefikbuild_of_quarkusnexus_3524self_node_remediation_operatorcrosswork_data_gatewaycontournode_maintenance_operatorcbl-marinernexus_9716d-gxsinec_insh2onexus_9332d-gx2bnexus_9372px_switchapisixjboss_core_servicesnexus_9500_16-slotsimatic_s7-1500_cpu_1518-4_pn\/dp_mfp_firmwareoncommand_insightnexus_9372px-enexus_9336pq_aci_spinenexus_3548-xnexus_9221cnexus_9272q_switchnexus_93108tc-fxfirepower_threat_defensebig-ip_fraud_protection_servicewindows_server_2019migration_toolkit_for_virtualizationvarnish_cacheunified_contact_center_enterprisenexus_93108tc-fx3hnexus_93240tc-fx2asp.net_coretelepresence_video_communication_servernexus_93216tc-fx2nexus_3100traffic_servernexus_3064-xnexus_9348gc-fx3nexus_9332cbig-ip_application_visibility_and_reportingnexus_3132q-x\/3132q-xltomcatwindows_10_1607simatic_s7-1500_cpu_1518f-4_pn\/dp_mfp_firmwarenexus_3172tq-xlnexus_3548-xlnexus_9336pq_aci_spine_switchsiplus_s7-1500_cpu_1518-4_pn\/dp_mfpnexus_3164qdebian_linuxnexus_9396px_switchnexus_9396pxlogging_subsystem_for_red_hat_openshiftnexus_9364cbig-ip_webacceleratoropenshift_serverlessnetworkingnexus_9500big-ip_ssl_orchestratornexus_93180yc-ex_switchnexus_9508nexus_3132q-xnexus_93120txnexus_3132q-xlnexus_9408ruggedcom_ape1808_firmwarenexus_34180ycnexus_93180yc-fx3snx-osnexus_93180lc-exunified_contact_center_management_portalnexus_92304qc_switchdata_center_network_manageropenrestynexus_92348gc-xbig-ip_application_acceleration_manageropenshift_virtualizationnexus_93108tc-fx3pnexus_93360yc-fx2nexus_3172pq-xlnexus_31108pv-vgrpcnexus_93128txnexus_3064-tadvanced_cluster_management_for_kubernetesbig-ip_advanced_web_application_firewallenvoynexus_3232c_big-ip_global_traffic_managernginxfence_agents_remediation_operatorjboss_data_gridios_xrfog_directorsimatic_s7-1500_cpu_1518f-4_pn\/dp_mfpbig-ip_carrier-grade_natnexus_9300windows_11_21h2secure_web_applianceintegration_service_registryhttp2openshift_dev_spacesbig-ip_ddos_hybrid_defendernexus_93180yc-fx3hservice_interconnectnghttp2openshift_data_sciencest7_scadaconnectnexus_93120tx_switchbig-ip_local_traffic_managerbig-ip_access_policy_managerjboss_fuseopenshift_container_platformopenshift_pipelinesnexus_3048nexus_9508_switchnettynexus_9336c-fx2-enexus_93600cd-gxnexus_34200yc-smnexus_9516_switchceph_storagenexus_3600jboss_a-mqrun_once_duration_override_operatornexus_9000vnexus_3172nexus_3500sinec_nmsruggedcom_ape1808nexus_9336pq_acinexus_9316d-gxnexus_9800kong_gatewayadvanced_cluster_securitynexus_3548-x\/xlunified_contact_center_enterprise_-_live_data_serverultra_cloud_core_-_policy_control_functionbig-ip_next_service_proxy_for_kubernetesnexus_9232enexus_9808jboss_a-mq_streamsnexus_92304qciot_field_network_directornexus_9500_8-slotmigration_toolkit_for_applicationsnexus_3200solrjenkinsnginx_ingress_controllernexus_93180yc-exnexus_9372tx-e_switchnexus_93108tc-exnexus_9504_switchnexus_3524-x\/xlnexus_3548service_telemetry_frameworkenterprise_linuxn/aRUGGEDCOM APE1808SINEC NMSSIPLUS S7-1500 CPU 1518-4 PN/DP MFPSIMATIC S7-1500 CPU 1518F-4 PN/DP MFPSIMATIC S7-1500 CPU 1518-4 PN/DP MFPhttpHTTP/2
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2025-58057
Matching Score-8
Assigner-GitHub, Inc.
ShareView Details
Matching Score-8
Assigner-GitHub, Inc.
CVSS Score-6.9||MEDIUM
EPSS-0.06% / 19.91%
||
7 Day CHG~0.00%
Published-03 Sep, 2025 | 21:46
Updated-08 Sep, 2025 | 16:45
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty's BrotliDecoder is vulnerable to DoS via zip bomb style attack

Netty is an asynchronous event-driven network application framework for rapid development of maintainable high performance protocol servers & clients. In netty-codec-compression versions 4.1.124.Final and below, and netty-codec versions 4.2.4.Final and below, when supplied with specially crafted input, BrotliDecoder and certain other decompression decoders will allocate a large number of reachable byte buffers, which can lead to denial of service. BrotliDecoder.decompress has no limit in how often it calls pull, decompressing data 64K bytes at a time. The buffers are saved in the output list, and remain reachable until OOM is hit. This is fixed in versions 4.1.125.Final of netty-codec and 4.2.5.Final of netty-codec-compression.

Action-Not Available
Vendor-The Netty Project
Product-nettynetty
CWE ID-CWE-409
Improper Handling of Highly Compressed Data (Data Amplification)
CVE-2026-42582
Matching Score-8
Assigner-GitHub, Inc.
ShareView Details
Matching Score-8
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-0.02% / 4.32%
||
7 Day CHG~0.00%
Published-13 May, 2026 | 18:06
Updated-18 May, 2026 | 12:54
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty: HTTP/3 QPACK literal unbounded allocation

Netty is an asynchronous, event-driven network application framework. Prior to 4.2.13.Final, when decoding header blocks, the non-Huffman branch of io.netty.handler.codec.http3.QpackDecoder#decodeHuffmanEncodedLiteral may execute new byte[length] for a string literal before verifying that length bytes are actually present in the compressed field section. The wire encoding allows a very large length to be expressed in few bytes. There is no check that length <= in.readableBytes() before new byte[length]. This vulnerability is fixed in 4.2.13.Final.

Action-Not Available
Vendor-io.nettyThe Netty Project
Product-nettynettynetty-codec-http3
CWE ID-CWE-770
Allocation of Resources Without Limits or Throttling
CWE ID-CWE-789
Memory Allocation with Excessive Size Value
CVE-2022-41881
Matching Score-8
Assigner-GitHub, Inc.
ShareView Details
Matching Score-8
Assigner-GitHub, Inc.
CVSS Score-5.3||MEDIUM
EPSS-0.47% / 65.12%
||
7 Day CHG+0.02%
Published-12 Dec, 2022 | 00:00
Updated-22 Apr, 2025 | 15:57
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

Netty project is an event-driven asynchronous network application framework. In versions prior to 4.1.86.Final, a StackOverflowError can be raised when parsing a malformed crafted message due to an infinite recursion. This issue is patched in version 4.1.86.Final. There is no workaround, except using a custom HaProxyMessageDecoder.

Action-Not Available
Vendor-Debian GNU/LinuxThe Netty Project
Product-nettydebian_linuxnetty
CWE ID-CWE-674
Uncontrolled Recursion
CVE-2016-4970
Matching Score-8
Assigner-Red Hat, Inc.
ShareView Details
Matching Score-8
Assigner-Red Hat, Inc.
CVSS Score-7.5||HIGH
EPSS-8.23% / 92.41%
||
7 Day CHG~0.00%
Published-13 Apr, 2017 | 14:00
Updated-13 May, 2026 | 00:24
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

handler/ssl/OpenSslEngine.java in Netty 4.0.x before 4.0.37.Final and 4.1.x before 4.1.1.Final allows remote attackers to cause a denial of service (infinite loop).

Action-Not Available
Vendor-n/aThe Netty ProjectThe Apache Software FoundationRed Hat, Inc.
Product-jboss_data_gridnettyjboss_middleware_text-only_advisoriescassandran/a
CWE ID-CWE-835
Loop with Unreachable Exit Condition ('Infinite Loop')
CVE-2021-37137
Matching Score-8
Assigner-JFrog
ShareView Details
Matching Score-8
Assigner-JFrog
CVSS Score-7.5||HIGH
EPSS-2.38% / 85.34%
||
7 Day CHG~0.00%
Published-19 Oct, 2021 | 00:00
Updated-04 Aug, 2024 | 01:16
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

The Snappy frame decoder function doesn't restrict the chunk length which may lead to excessive memory usage. Beside this it also may buffer reserved skippable chunks until the whole chunk was received which may lead to excessive memory usage as well. This vulnerability can be triggered by supplying malicious input that decompresses to a very big size (via a network stream or a file) or by sending a huge skippable chunk.

Action-Not Available
Vendor-quarkusThe Netty ProjectNetApp, Inc.Debian GNU/LinuxOracle Corporation
Product-communications_diameter_signaling_routerbanking_apispeoplesoft_enterprise_peopletoolsdebian_linuxbanking_digital_experiencequarkusnettycommunications_cloud_native_core_binding_support_functioncommerce_guided_searchcommunications_brm_-_elastic_charging_enginewebcenter_portaloncommand_insightNetty
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2021-37136
Matching Score-8
Assigner-JFrog
ShareView Details
Matching Score-8
Assigner-JFrog
CVSS Score-7.5||HIGH
EPSS-1.19% / 79.22%
||
7 Day CHG~0.00%
Published-19 Oct, 2021 | 00:00
Updated-04 Aug, 2024 | 01:16
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

The Bzip2 decompression decoder function doesn't allow setting size restrictions on the decompressed output data (which affects the allocation size used during decompression). All users of Bzip2Decoder are affected. The malicious input can trigger an OOME and so a DoS attack

Action-Not Available
Vendor-quarkusThe Netty ProjectNetApp, Inc.Debian GNU/LinuxOracle Corporation
Product-communications_diameter_signaling_routercoherencepeoplesoft_enterprise_peopletoolscommunications_cloud_native_core_network_slice_selection_functionbanking_digital_experiencequarkuscommunications_cloud_native_core_security_edge_protection_proxyhelidoncommunications_instant_messaging_servercommunications_cloud_native_core_policycommunications_brm_-_elastic_charging_enginebanking_apisdebian_linuxcommunications_cloud_native_core_unified_data_repositorynettycommunications_cloud_native_core_binding_support_functioncommerce_guided_searchwebcenter_portaloncommand_insightNetty
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2026-42579
Matching Score-6
Assigner-GitHub, Inc.
ShareView Details
Matching Score-6
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-0.03% / 9.79%
||
7 Day CHG~0.00%
Published-13 May, 2026 | 18:01
Updated-18 May, 2026 | 17:16
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty: DNS Codec Input Validation Bypass in Netty (Encoder + Decoder)

Netty is an asynchronous, event-driven network application framework. Prior to 4.2.13.Final and 4.1.133.Final, Netty's DNS codec does not enforce RFC 1035 domain name constraints during either encoding or decoding. This creates a bidirectional attack surface: malicious DNS responses can exploit the decoder, and user-influenced hostnames can exploit the encoder. This vulnerability is fixed in 4.2.13.Final and 4.1.133.Final.

Action-Not Available
Vendor-The Netty Project
Product-nettynetty
CWE ID-CWE-20
Improper Input Validation
CWE ID-CWE-400
Uncontrolled Resource Consumption
CWE ID-CWE-626
Null Byte Interaction Error (Poison Null Byte)
CVE-2015-2156
Matching Score-6
Assigner-MITRE Corporation
ShareView Details
Matching Score-6
Assigner-MITRE Corporation
CVSS Score-7.5||HIGH
EPSS-3.27% / 87.45%
||
7 Day CHG~0.00%
Published-18 Oct, 2017 | 15:00
Updated-13 May, 2026 | 00:24
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

Netty before 3.9.8.Final, 3.10.x before 3.10.3.Final, 4.0.x before 4.0.28.Final, and 4.1.x before 4.1.0.Beta5 and Play Framework 2.x before 2.3.9 might allow remote attackers to bypass the httpOnly flag on cookies and obtain sensitive information by leveraging improper validation of cookie name and value characters.

Action-Not Available
Vendor-playframeworklightbendn/aThe Netty Project
Product-play_frameworknettyn/a
CWE ID-CWE-20
Improper Input Validation
CVE-2024-40642
Matching Score-6
Assigner-GitHub, Inc.
ShareView Details
Matching Score-6
Assigner-GitHub, Inc.
CVSS Score-8.1||HIGH
EPSS-0.70% / 72.52%
||
7 Day CHG~0.00%
Published-18 Jul, 2024 | 22:21
Updated-02 Aug, 2024 | 04:33
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Absent Input Validation in BinaryHttpParser in the netty incubator codec.bhttp

The netty incubator codec.bhttp is a java language binary http parser. In affected versions the `BinaryHttpParser` class does not properly validate input values thus giving attackers almost complete control over the HTTP requests constructed from the parsed output. Attackers can abuse several issues individually to perform various injection attacks including HTTP request smuggling, desync attacks, HTTP header injections, request queue poisoning, caching attacks and Server Side Request Forgery (SSRF). Attacker could also combine several issues to create well-formed messages for other text-based protocols which may result in attacks beyond the HTTP protocol. The BinaryHttpParser class implements the readRequestHead method which performs most of the relevant parsing of the received request. The data structure prefixes values with a variable length integer value. The parsing code below first gets the lengths of the values from the prefixed variable length integer. After it has all of the lengths and calculates all of the indices, the parser casts the applicable slices of the ByteBuf to String. Finally, it passes these values into a new `DefaultBinaryHttpRequest` object where no further parsing or validation occurs. Method is partially validated while other values are not validated at all. Software that relies on netty to apply input validation for binary HTTP data may be vulnerable to various injection and protocol based attacks. This issue has been addressed in version 0.0.13.Final. Users are advised to upgrade. There are no known workarounds for this vulnerability.

Action-Not Available
Vendor-The Netty Project
Product-netty-incubator-codec-ohttpnetty-incubator-codec-ohttp
CWE ID-CWE-20
Improper Input Validation
CVE-2022-1302
Matching Score-4
Assigner-CERT@VDE
ShareView Details
Matching Score-4
Assigner-CERT@VDE
CVSS Score-7.5||HIGH
EPSS-0.98% / 77.19%
||
7 Day CHG~0.00%
Published-12 Apr, 2022 | 07:30
Updated-16 Sep, 2024 | 18:02
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Malformed Goose Message in LibIEC61850 may result in a denial of service

In the MZ Automation LibIEC61850 in versions prior to 1.5.1 an unauthenticated attacker can craft a goose message, which may result in a denial of service.

Action-Not Available
Vendor-mz-automationMZ Automation
Product-libiec61850libIEC61850
CWE ID-CWE-20
Improper Input Validation
CVE-2025-61612
Matching Score-4
Assigner-Unisoc (Shanghai) Technologies Co., Ltd.
ShareView Details
Matching Score-4
Assigner-Unisoc (Shanghai) Technologies Co., Ltd.
CVSS Score-7.5||HIGH
EPSS-0.07% / 22.03%
||
7 Day CHG~0.00%
Published-09 Mar, 2026 | 09:02
Updated-09 Mar, 2026 | 21:16
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

In nr modem, there is a possible system crash due to improper input validation. This could lead to remote denial of service with no additional execution privileges needed.

Action-Not Available
Vendor-Google LLCUnisoc (Shanghai) Technologies Co., Ltd.
Product-t8300androidt8200t7300t8100t9100T7300/T8100/T9100/T8200/T8300
CWE ID-CWE-20
Improper Input Validation
CVE-2025-61582
Matching Score-4
Assigner-GitHub, Inc.
ShareView Details
Matching Score-4
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-0.20% / 41.82%
||
7 Day CHG+0.02%
Published-01 Oct, 2025 | 22:20
Updated-20 Oct, 2025 | 18:07
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Ts3 Manager: Unauthenticated Denial of Service possible through specially crafted Unicode input

TS3 Manager is modern web interface for maintaining Teamspeak3 servers. A Denial of Dervice vulnerability has been identified in versions 2.2.1 and earlier. The vulnerability permits an unauthenticated actor to crash the application through the submission of specially crafted Unicode input, requiring no prior authentication or privileges. The flaw manifests when Unicode tag characters are submitted to the Server field on the login page. The application fails to properly handle these characters during the ASCII conversion process, resulting in an unhandled exception that terminates the application within four to five seconds of submission. This issue is fixed in version 2.2.2.

Action-Not Available
Vendor-joni1802joni1802
Product-ts3_managerts3-manager
CWE ID-CWE-20
Improper Input Validation
CVE-2020-14513
Matching Score-4
Assigner-Cybersecurity and Infrastructure Security Agency (CISA) Industrial Control Systems (ICS)
ShareView Details
Matching Score-4
Assigner-Cybersecurity and Infrastructure Security Agency (CISA) Industrial Control Systems (ICS)
CVSS Score-7.5||HIGH
EPSS-0.26% / 49.50%
||
7 Day CHG~0.00%
Published-16 Sep, 2020 | 19:49
Updated-04 Aug, 2024 | 12:46
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

CodeMeter (All versions prior to 6.81) and the software using it may crash while processing a specifically crafted license file due to unverified length fields.

Action-Not Available
Vendor-wibun/a
Product-codemeterCodeMeter
CWE ID-CWE-20
Improper Input Validation
CVE-2025-61613
Matching Score-4
Assigner-Unisoc (Shanghai) Technologies Co., Ltd.
ShareView Details
Matching Score-4
Assigner-Unisoc (Shanghai) Technologies Co., Ltd.
CVSS Score-7.5||HIGH
EPSS-0.07% / 22.03%
||
7 Day CHG~0.00%
Published-09 Mar, 2026 | 09:02
Updated-09 Mar, 2026 | 21:16
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

In nr modem, there is a possible system crash due to improper input validation. This could lead to remote denial of service with no additional execution privileges needed.

Action-Not Available
Vendor-Google LLCUnisoc (Shanghai) Technologies Co., Ltd.
Product-t8300androidt8200t8100t9100T8100/T9100/T8200/T8300
CWE ID-CWE-20
Improper Input Validation
CVE-2025-61616
Matching Score-4
Assigner-Unisoc (Shanghai) Technologies Co., Ltd.
ShareView Details
Matching Score-4
Assigner-Unisoc (Shanghai) Technologies Co., Ltd.
CVSS Score-7.5||HIGH
EPSS-0.10% / 26.45%
||
7 Day CHG~0.00%
Published-09 Mar, 2026 | 09:02
Updated-09 Mar, 2026 | 21:16
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

In nr modem, there is a possible system crash due to improper input validation. This could lead to remote denial of service with no additional execution privileges needed.

Action-Not Available
Vendor-Google LLCUnisoc (Shanghai) Technologies Co., Ltd.
Product-t8300androidt8200t8100t9100T8100/T9100/T8200/T8300
CWE ID-CWE-20
Improper Input Validation
CVE-2025-61920
Matching Score-4
Assigner-GitHub, Inc.
ShareView Details
Matching Score-4
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-0.42% / 62.63%
||
7 Day CHG~0.00%
Published-10 Oct, 2025 | 19:25
Updated-03 Nov, 2025 | 18:17
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Authlib is vulnerable to Denial of Service via Oversized JOSE Segments

Authlib is a Python library which builds OAuth and OpenID Connect servers. Prior to version 1.6.5, Authlib’s JOSE implementation accepts unbounded JWS/JWT header and signature segments. A remote attacker can craft a token whose base64url‑encoded header or signature spans hundreds of megabytes. During verification, Authlib decodes and parses the full input before it is rejected, driving CPU and memory consumption to hostile levels and enabling denial of service. Version 1.6.5 patches the issue. Some temporary workarounds are available. Enforce input size limits before handing tokens to Authlib and/or use application-level throttling to reduce amplification risk.

Action-Not Available
Vendor-authlibauthlib
Product-authlibauthlib
CWE ID-CWE-20
Improper Input Validation
CWE ID-CWE-400
Uncontrolled Resource Consumption
CWE ID-CWE-770
Allocation of Resources Without Limits or Throttling
CVE-2025-59028
Matching Score-4
Assigner-Open-Xchange
ShareView Details
Matching Score-4
Assigner-Open-Xchange
CVSS Score-5.3||MEDIUM
EPSS-0.09% / 25.51%
||
7 Day CHG~0.00%
Published-27 Mar, 2026 | 08:10
Updated-30 Apr, 2026 | 17:50
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

When sending invalid base64 SASL data, login process is disconnected from the auth server, causing all active authentication sessions to fail. Invalid BASE64 data can be used to DoS a vulnerable server to break concurrent logins. Install fixed version or disable concurrency in login processes (heavy perfomance penalty on large deployments). No publicly available exploits are known.

Action-Not Available
Vendor-Open-Xchange AGDovecot
Product-dovecotOX Dovecot Pro
CWE ID-CWE-20
Improper Input Validation
CVE-2025-59537
Matching Score-4
Assigner-GitHub, Inc.
ShareView Details
Matching Score-4
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-0.33% / 56.30%
||
7 Day CHG+0.03%
Published-01 Oct, 2025 | 21:01
Updated-07 Oct, 2025 | 14:34
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
argo-cd is vulnerable to unauthenticated DoS attack via malformed Gogs webhook payload

Argo CD is a declarative, GitOps continuous delivery tool for Kubernetes. Versions 1.2.0 through 1.8.7, 2.0.0-rc1 through 2.14.19, 3.0.0-rc1 through 3.2.0-rc1, 3.1.7 and 3.0.18 are vulnerable to malicious API requests which can crash the API server and cause denial of service to legitimate clients. With the default configuration, no webhook.gogs.secret set, Argo CD’s /api/webhook endpoint will crash the entire argocd-server process when it receives a Gogs push event whose JSON field commits[].repo is not set or is null. This issue is fixed in versions 2.14.20, 3.2.0-rc2, 3.1.8 and 3.0.19.

Action-Not Available
Vendor-argoprojargoproj
Product-argo_cdargo-cd
CWE ID-CWE-20
Improper Input Validation
CWE ID-CWE-476
NULL Pointer Dereference
CVE-2025-59301
Matching Score-4
Assigner-Delta Electronics, Inc.
ShareView Details
Matching Score-4
Assigner-Delta Electronics, Inc.
CVSS Score-4||MEDIUM
EPSS-0.04% / 12.55%
||
7 Day CHG~0.00%
Published-22 Dec, 2025 | 02:56
Updated-08 Jan, 2026 | 13:30
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Modbus/TCP Dos Vulnerability in DVP15MC11T

Delta Electronics DVP15MC11T lacks proper validation of the modbus/tcp packets and can lead to denial of service.

Action-Not Available
Vendor-Delta Electronics, Inc.
Product-dvp15mc11t_firmwaredvp15mc11tDVP15MC11T
CWE ID-CWE-20
Improper Input Validation
CVE-2020-15379
Matching Score-4
Assigner-Brocade Communications Systems, LLC
ShareView Details
Matching Score-4
Assigner-Brocade Communications Systems, LLC
CVSS Score-7.5||HIGH
EPSS-0.45% / 64.02%
||
7 Day CHG~0.00%
Published-09 Jun, 2021 | 15:15
Updated-04 Aug, 2024 | 13:15
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

Brocade SANnav before v.2.1.0a could allow remote attackers cause a denial-of-service condition due to a lack of proper validation, of the length of user-supplied data as name for custom field name.

Action-Not Available
Vendor-n/aBroadcom Inc.
Product-brocade_sannavBrocade SANnav
CWE ID-CWE-20
Improper Input Validation
CVE-2025-59895
Matching Score-4
Assigner-Spanish National Cybersecurity Institute, S.A. (INCIBE)
ShareView Details
Matching Score-4
Assigner-Spanish National Cybersecurity Institute, S.A. (INCIBE)
CVSS Score-8.2||HIGH
EPSS-0.03% / 10.18%
||
7 Day CHG~0.00%
Published-28 Jan, 2026 | 11:55
Updated-10 Feb, 2026 | 21:07
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Remote denial-of-service (DoS) vulnerability in Sync Breeze Enterprise Server

Sync Breeze Enterprise Server v10.4.18 and Disk Pulse Enterprise v10.4.18 contain a remote denial-of-service (DoS) vulnerability in the configuration restore functionality. The issue is due to insufficient validation of user-supplied data during this process. An attacker could send malicious requests to alter the configuration file, causing the application to become unresponsive. In a successful scenario, the service may not recover on its own and require a complete reinstallation, as the configuration becomes corrupted and prevents the service from restarting, even manually.

Action-Not Available
Vendor-flexenseFlexense
Product-diskpulsesyncbreezeDisk Pulse EnterpriseSync Breeze Enterprise Server
CWE ID-CWE-20
Improper Input Validation
CVE-2021-26036
Matching Score-4
Assigner-Joomla! Project
ShareView Details
Matching Score-4
Assigner-Joomla! Project
CVSS Score-7.5||HIGH
EPSS-0.01% / 2.61%
||
7 Day CHG~0.00%
Published-07 Jul, 2021 | 10:12
Updated-25 Feb, 2026 | 05:05
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
[20210702] - Core - DoS through usergroup table manipulation

An issue was discovered in Joomla! 2.5.0 through 3.9.27. Missing validation of input could lead to a broken usergroups table.

Action-Not Available
Vendor-Joomla!
Product-joomla\!Joomla! CMS
CWE ID-CWE-20
Improper Input Validation
CVE-2025-57834
Matching Score-4
Assigner-MITRE Corporation
ShareView Details
Matching Score-4
Assigner-MITRE Corporation
CVSS Score-7.5||HIGH
EPSS-0.13% / 32.35%
||
7 Day CHG~0.00%
Published-06 Apr, 2026 | 00:00
Updated-07 Apr, 2026 | 17:31
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

An issue was discovered in Samsung Mobile Processor, Wearable Processor, and Modem (Exynos 980, 850, 990, 1080, 2100, 1280, 2200, 1330, 1380, 1480, 2400, 1580, 2500, 1680, 9110, W920, W930, W1000, Modem 5123, Modem 5300, Modem 5400, and Modem 5410). The absence of proper input validation leads to a Denial of Service.

Action-Not Available
Vendor-n/aSamsung
Product-exynos_2400exynos_1330exynos_980_firmwareexynos_2500_firmwareexynos_2200exynos_1080exynos_modem_5410_firmwareexynos_1480_firmwareexynos_9110exynos_850exynos_w920exynos_modem_5300_firmwareexynos_1280_firmwareexynos_modem_5410exynos_modem_5400_firmwareexynos_w920_firmwareexynos_1680exynos_850_firmwareexynos_modem_5123exynos_2400_firmwareexynos_1380_firmwareexynos_990exynos_modem_5123_firmwareexynos_990_firmwareexynos_w1000_firmwareexynos_2200_firmwareexynos_w930_firmwareexynos_w930exynos_1330_firmwareexynos_2500exynos_1680_firmwareexynos_w1000exynos_1080_firmwareexynos_1280exynos_980exynos_9110_firmwareexynos_modem_5400exynos_2100exynos_1580_firmwareexynos_2100_firmwareexynos_modem_5300exynos_1580exynos_1380exynos_1480n/a
CWE ID-CWE-20
Improper Input Validation
CVE-2020-15203
Matching Score-4
Assigner-GitHub, Inc.
ShareView Details
Matching Score-4
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-0.36% / 58.58%
||
7 Day CHG~0.00%
Published-25 Sep, 2020 | 18:46
Updated-04 Aug, 2024 | 13:08
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Denial of Service in Tensorflow

In Tensorflow before versions 1.15.4, 2.0.3, 2.1.2, 2.2.1 and 2.3.1, by controlling the `fill` argument of tf.strings.as_string, a malicious attacker is able to trigger a format string vulnerability due to the way the internal format use in a `printf` call is constructed. This may result in segmentation fault. The issue is patched in commit 33be22c65d86256e6826666662e40dbdfe70ee83, and is released in TensorFlow versions 1.15.4, 2.0.3, 2.1.2, 2.2.1, or 2.3.1.

Action-Not Available
Vendor-Google LLCopenSUSETensorFlow
Product-tensorflowleaptensorflow
CWE ID-CWE-20
Improper Input Validation
CWE ID-CWE-134
Use of Externally-Controlled Format String
CVE-2020-15206
Matching Score-4
Assigner-GitHub, Inc.
ShareView Details
Matching Score-4
Assigner-GitHub, Inc.
CVSS Score-9||CRITICAL
EPSS-0.47% / 65.13%
||
7 Day CHG~0.00%
Published-25 Sep, 2020 | 18:45
Updated-04 Aug, 2024 | 13:08
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Denial of Service in Tensorflow

In Tensorflow before versions 1.15.4, 2.0.3, 2.1.2, 2.2.1 and 2.3.1, changing the TensorFlow's `SavedModel` protocol buffer and altering the name of required keys results in segfaults and data corruption while loading the model. This can cause a denial of service in products using `tensorflow-serving` or other inference-as-a-service installments. Fixed were added in commits f760f88b4267d981e13f4b302c437ae800445968 and fcfef195637c6e365577829c4d67681695956e7d (both going into TensorFlow 2.2.0 and 2.3.0 but not yet backported to earlier versions). However, this was not enough, as #41097 reports a different failure mode. The issue is patched in commit adf095206f25471e864a8e63a0f1caef53a0e3a6, and is released in TensorFlow versions 1.15.4, 2.0.3, 2.1.2, 2.2.1, or 2.3.1.

Action-Not Available
Vendor-Google LLCopenSUSETensorFlow
Product-tensorflowleaptensorflow
CWE ID-CWE-20
Improper Input Validation
CVE-2021-45711
Matching Score-4
Assigner-MITRE Corporation
ShareView Details
Matching Score-4
Assigner-MITRE Corporation
CVSS Score-7.5||HIGH
EPSS-0.58% / 69.31%
||
7 Day CHG~0.00%
Published-26 Dec, 2021 | 21:47
Updated-04 Aug, 2024 | 04:47
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

An issue was discovered in the simple_asn1 crate 0.6.0 before 0.6.1 for Rust. There is a panic if UTCTime data, supplied by a remote attacker, has a second character greater than 0x7f.

Action-Not Available
Vendor-simple_asn1_projectn/a
Product-simple_asn1n/a
CWE ID-CWE-20
Improper Input Validation
CVE-2021-44354
Matching Score-4
Assigner-Talos
ShareView Details
Matching Score-4
Assigner-Talos
CVSS Score-8.6||HIGH
EPSS-0.30% / 54.10%
||
7 Day CHG~0.00%
Published-14 Apr, 2022 | 19:56
Updated-15 Apr, 2025 | 19:06
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

Multiple denial of service vulnerabilities exist in the cgiserver.cgi JSON command parser functionality of Reolink RLC-410W v3.0.0.136_20121102. A specially-crafted HTTP request can lead to a reboot. An attacker can send an HTTP request to trigger this vulnerability.

Action-Not Available
Vendor-Reolink Innovation Limited
Product-rlc-410w_firmwarerlc-410wRLC-410W
CWE ID-CWE-20
Improper Input Validation
CVE-2021-44355
Matching Score-4
Assigner-Talos
ShareView Details
Matching Score-4
Assigner-Talos
CVSS Score-8.6||HIGH
EPSS-0.30% / 54.10%
||
7 Day CHG~0.00%
Published-14 Apr, 2022 | 19:56
Updated-15 Apr, 2025 | 19:06
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

Multiple denial of service vulnerabilities exist in the cgiserver.cgi JSON command parser functionality of Reolink RLC-410W v3.0.0.136_20121102. A specially-crafted HTTP request can lead to a reboot. An attacker can send an HTTP request to trigger this vulnerability.

Action-Not Available
Vendor-Reolink Innovation Limited
Product-rlc-410w_firmwarerlc-410wRLC-410W
CWE ID-CWE-20
Improper Input Validation
CVE-2021-44694
Matching Score-4
Assigner-Siemens
ShareView Details
Matching Score-4
Assigner-Siemens
CVSS Score-5.5||MEDIUM
EPSS-0.19% / 41.06%
||
7 Day CHG~0.00%
Published-13 Dec, 2022 | 00:00
Updated-21 Apr, 2025 | 13:45
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

Affected devices don't process correctly certain special crafted packets sent to port 102/tcp, which could allow an attacker to cause a denial of service in the device.

Action-Not Available
Vendor-Siemens AG
Product-simatic_s7-1500_cpu_1507ssimatic_s7-1200_cpu_12_1214fcsimatic_s7-1500_cpu_cpu_1513pro-2simatic_s7-1500_cpu_1511csimatic_s7-1500_cpu_1511t-1_firmwaresimatic_s7-1500_cpu_1512sp-1siplus_et_200sp_cp_1543sp-1_isec_tx_rail_firmwaresimatic_et_200_sp_open_controller_cpu_1515sp_pc_firmwaresimatic_s7-1200_cpu_12_1214c_firmwaresimatic_s7-1200_cpu_12_1211csimatic_s7-1500_cpu_1508s_f_firmwaresimatic_s7-1500_cpu_1510sp-1simatic_s7-1200_cpu_1212csimatic_s7-1500_cpu_1512spf-1simatic_s7-1500_cpu_1513-1simatic_s7-1200_cpu_1212fc_firmwaresimatic_s7-1500_cpu_1517-3_pnsimatic_s7-1500_cpu_1515-2_pn_firmwaresimatic_s7-1500_cpu_1517f-3_pn\/dpsimatic_s7-1500_cpu_1513r-1simatic_s7-1200_cpu_1215_fcsimatic_s7-1500_cpu_1512c_firmwaresimatic_s7-1500_cpu_1517f-3_pn\/dp_firmwaresimatic_s7-1200_cpu_12_1215csimatic_s7-1500_cpu_1511-1_firmwaresimatic_s7-1500_cpu_1511-1_pnsimatic_s7-1500_cpu_1517f-3_firmwaresimatic_s7-1500_cpu_1518f-4_pn\/dp_firmwaresimatic_s7-1500_cpu_1518hf-4simatic_s7-1500_cpu_1518-4_pn_firmwaresiplus_tim_1531_irc_firmwaresimatic_s7-1500_cpu_1518-4_dp_firmwaresimatic_s7-1500_cpu_1516tf-3_firmwaresimatic_s7-1500_cpu_1511f-1_pn_firmwaresimatic_s7-1500_cpu_1516-3_firmwaresimatic_s7-1500_cpu_1518-4_pn\/dp_mfp_firmwaresimatic_s7-1500_cpu_1517-3_pn\/dpsimatic_s7-1500_cpu_1517-3simatic_s7-1500_cpu_1518t-4_firmwaresimatic_s7-1500_cpu_1508s_fsimatic_s7-1500_cpu_15prof-2_firmwaresimatic_s7-1500_cpu_1513f-1_pnsimatic_s7-1200_cpu_1214c_firmwaresimatic_s7-1500_cpu_1517-3_pn_firmwaresimatic_s7-1500_cpu_1517-3_dpsimatic_s7-1200_cpu_12_1214csimatic_s7-1200_cpu_1211c_firmwaresimatic_s7-1500_cpu_cpu_1513pro-2_firmwaresimatic_s7-1200_cpu_1214csiplus_tim_1531_ircsimatic_s7-1500_cpu_15prof-2simatic_s7-1500_cpu_1516tf-3simatic_s7-1500_cpu_1516f-3_pn\/dp_firmwaresimatic_s7-1500_cpu_151511f-1_firmwaresimatic_s7-1500_cpu_1507s_f_firmwaresimatic_s7-1500_cpu_1516t-3_firmwaresimatic_s7-1500_cpu_1511t-1simatic_s7-1500_cpu_1517tf-3simatic_s7-1500_cpu_1515-2_pnsimatic_s7-1200_cpu_1214_fcsimatic_s7-1500_cpu_1515-2_firmwaresimatic_s7-1500_cpu_1516pro-2_firmwaretim_1531_irc_firmwaresimatic_s7-1500_cpu_1515-2simatic_s7-1500_cpu_1516-3_pnsimatic_s7-1500_cpu_1516pro_f_firmwaresimatic_s7-1500_cpu_1516-3simatic_s7-1200_cpu_1214fcsimatic_s7-1500_cpu_1518f-4_pn\/dpsimatic_s7-1500_cpu_1508s_firmwaresimatic_s7-1500_cpu_1511f-1_firmwaresimatic_s7-1200_cpu_12_1212fcsimatic_s7-1500_cpu_151511c-1simatic_s7-1500_cpu_1518tf-4_firmwaresiplus_s7-1200_cp_1243-1simatic_s7-1500_cpu_1511f-1_pnsimatic_s7-1500_cpu_1507s_fsimatic_s7-1500_cpu_1518simatic_s7-1500_cpu_1513-1_pn_firmwaresimatic_s7-1200_cpu_1215fcsimatic_s7-1500_cpu_1518f-4simatic_s7-1500_cpu_1516pro_fsimatic_s7-1500_cpu_1513r-1_firmwaresimatic_et_200_sp_open_controller_cpu_1515sp_pcsimatic_s7-1500_cpu_1512c-1_firmwaresimatic_s7-1500_cpu_1513f-1_pn_firmwaresiplus_et_200sp_cp_1543sp-1_isec_firmwaresimatic_s7-1500_cpu_1518_firmwaresimatic_s7-1500_cpu_1518-4_firmwaresimatic_s7-1500_cpu_1518tf-4simatic_s7-1200_cpu_1214_fc_firmwaresiplus_s7-1200_cp_1243-1_railsimatic_s7-1500_cpu_1516t-3simatic_s7-1500_cpu_1510sp_firmwaresimatic_s7-1500_cpu_1518-4_pn\/dp_mfpsiplus_et_200sp_cp_1542sp-1_irc_tx_rail_firmwaresimatic_s7-1200_cpu_1215_fc_firmwaresimatic_s7-1200_cpu_12_1215fc_firmwaresimatic_s7-1500_cpu_1515t-2simatic_s7-1500_cpu_15pro-2simatic_s7-1500_cpu_1518-4_pnsimatic_s7-1200_cpu_12_1212c_firmwaresimatic_s7-1200_cpu_12_1212fc_firmwaresimatic_s7-1500_cpu_1511-1_pn_firmwaresimatic_s7-1500_cpu_15pro-2_firmwaresimatic_s7-1500_cpu_1515tf-2_firmwaretim_1531_ircsimatic_s7-1500_cpu_151511c-1_firmwaresimatic_s7-1200_cpu_12_1217csimatic_s7-1500_cpu_1518-4_pn\/dp_firmwaresimatic_s7-1500_cpu_1510spsimatic_s7-1200_cpu_12_1217c_firmwaresimatic_s7-1500_cpu_1518f-4_firmwaresimatic_s7-1200_cpu_1217csimatic_s7-1500_cpu_151511f-1simatic_s7-1500_software_controller_firmwaresimatic_s7-1500_cpu_1511-1simatic_s7-1500_cpu_1518-4_dpsimatic_s7-1200_cpu_1215c_firmwaresimatic_s7-1500_cpu_1513-1_pnsimatic_s7-1200_cpu_1212c_firmwaresimatic_s7-1500_cpu_1515f-2_firmwaresimatic_s7-1200_cpu_1217c_firmwaresimatic_s7-1200_cpu_1214fc_firmwaresimatic_s7-1500_cpu_cpu_1513prof-2_firmwaresimatic_s7-1200_cpu_1215csimatic_s7-1500_cpu_1515r-2simatic_s7-1200_cpu_12_1215fcsiplus_et_200sp_cp_1543sp-1_isecsimatic_s7-1500_cpu_1513f-1simatic_s7-1500_cpu_1512csimatic_s7-1500_cpu_1516f-3_pn\/dpsimatic_s7-1500_cpu_1511c-1simatic_s7-1500_cpu_1517f-3simatic_s7-1500_cpu_1512spf-1_firmwaresiplus_et_200sp_cp_1543sp-1_isec_tx_railsimatic_s7-1500_cpu_1517tf-3_firmwaresimatic_s7-1500_cpu_1516f-3_firmwaresimatic_s7-1500_cpu_1517-3_firmwaresimatic_s7-1200_cpu_12_1214fc_firmwaresimatic_s7-1500_software_controllersimatic_s7-1500_cpu_1511c-1_firmwaresimatic_s7-1500_cpu_1517-3_dp_firmwaresimatic_s7-1500_cpu_1516-3_pn\/dp_firmwaresimatic_s7-1500_cpu_1518hf-4_firmwaresimatic_s7-1200_cpu_12_1212csimatic_s7-1500_cpu_1511f-1simatic_s7-1500_cpu_1515tf-2siplus_s7-1200_cp_1243-1_rail_firmwaresimatic_s7-1500_cpu_1511c_firmwaresimatic_s7-1500_cpu_1511tf-1simatic_s7-1500_cpu_1518-4simatic_s7-1500_cpu_1518-4_pn\/dpsiplus_s7-1200_cp_1243-1_firmwaresimatic_s7-1500_cpu_1511tf-1_firmwaresimatic_s7-1500_cpu_1517-3_pn\/dp_firmwaresimatic_s7-1500_cpu_1516-3_dpsimatic_s7-1500_cpu_1508ssimatic_s7-plcsim_advanced_firmwaresimatic_s7-1500_cpu_1510sp-1_firmwaresimatic_s7-1500_cpu_1516-3_pn\/dpsimatic_s7-1500_cpu_1515f-2_pn_firmwaresimatic_s7-1500_cpu_1515t-2_firmwaresiplus_et_200sp_cp_1542sp-1_irc_tx_railsimatic_s7-1500_cpu_1516-3_dp_firmwaresimatic_s7-1200_cpu_12_1215c_firmwaresimatic_s7-1500_cpu_1512sp-1_firmwaresimatic_s7-1200_cpu_1215fc_firmwaresimatic_s7-1500_cpu_1512c-1simatic_s7-1500_cpu_1515f-2simatic_s7-1500_cpu_cpu_1513prof-2simatic_s7-1500_cpu_1515f-2_pnsimatic_s7-1200_cpu_1211csimatic_s7-1500_cpu_1516f-3simatic_s7-1500_cpu_1516-3_pn_firmwaresimatic_s7-1200_cpu_12_1211c_firmwaresimatic_s7-plcsim_advancedsimatic_s7-1500_cpu_1513f-1_firmwaresimatic_s7-1200_cpu_1212fcsimatic_s7-1500_cpu_1516pro-2simatic_s7-1500_cpu_1515r-2_firmwaresimatic_s7-1500_cpu_1507s_firmwaresimatic_s7-1500_cpu_1513-1_firmwaresimatic_s7-1500_cpu_1518t-4SIMATIC S7-1500 CPU 1512C-1 PNSIMATIC S7-1500 CPU 1517F-3 PN/DPSIMATIC S7-1500 CPU 1515-2 PNSIMATIC S7-1500 CPU 1511T-1 PNSIPLUS S7-1500 CPU 1518-4 PN/DPSIPLUS S7-1500 CPU 1518F-4 PN/DPSIPLUS S7-1500 CPU 1518-4 PN/DP MFPSIMATIC S7-1500 CPU 1515TF-2 PNSIMATIC S7-1500 CPU 1510SP-1 PNSIMATIC S7-1500 CPU 1516-3 PN/DPSIMATIC S7-1500 CPU 1511TF-1 PNSIPLUS S7-1500 CPU 1515F-2 PNSIPLUS S7-1500 CPU 1517H-3 PNSIPLUS ET 200SP CPU 1510SP F-1 PN RAILSIMATIC S7-1500 CPU 1518HF-4 PNSIMATIC S7-1500 ET 200pro: CPU 1516PRO F-2 PNSIPLUS ET 200SP CPU 1512SP-1 PN RAILSIMATIC S7-1500 ET 200pro: CPU 1516PRO-2 PNSIPLUS ET 200SP CPU 1510SP-1 PN RAILSIMATIC S7-1500 ET 200pro: CPU 1513PRO-2 PNSIMATIC S7-PLCSIM AdvancedSIMATIC S7-1500 CPU 1517-3 PN/DPSIMATIC S7-1500 CPU 1517H-3 PNSIMATIC S7-1500 CPU 1516TF-3 PN/DPSIMATIC S7-1500 CPU 1515T-2 PNSIMATIC S7-1500 CPU S7-1518-4 PN/DP ODKSIMATIC S7-1500 ET 200pro: CPU 1513PRO F-2 PNSIPLUS S7-1500 CPU 1516-3 PN/DP RAILSIPLUS S7-1500 CPU 1516-3 PN/DP TX RAILSIMATIC S7-1500 CPU 1511C-1 PNSIMATIC S7-1500 CPU 1517TF-3 PN/DPSIMATIC S7-1200 CPU family (incl. SIPLUS variants)SIPLUS S7-1500 CPU 1515F-2 PN T2 RAILSIPLUS S7-1500 CPU 1511-1 PN TX RAILSIPLUS S7-1500 CPU 1513F-1 PNSIMATIC Drive Controller CPU 1507D TFSIMATIC Drive Controller CPU 1504D TFSIMATIC S7-1500 CPU 1513R-1 PNSIPLUS S7-1500 CPU 1516-3 PN/DPSIMATIC S7-1500 CPU 1515R-2 PNSIMATIC S7-1500 CPU 1512SP F-1 PNTIM 1531 IRCSIPLUS S7-1500 CPU 1511F-1 PNSIPLUS ET 200SP CPU 1512SP F-1 PN RAILSIMATIC S7-1500 Software Controller V2SIMATIC S7-1500 CPU 1518F-4 PN/DP MFPSIMATIC ET 200SP Open Controller CPU 1515SP PC2 (incl. SIPLUS variants)SIPLUS ET 200SP CPU 1512SP F-1 PNSIMATIC S7-1500 CPU 1515F-2 PNSIMATIC S7-1500 CPU 1518-4 PN/DPSIMATIC S7-1500 CPU 1513-1 PNSIPLUS ET 200SP CPU 1510SP F-1 PNSIMATIC S7-1500 CPU S7-1518F-4 PN/DP ODKSIMATIC S7-1500 CPU 1518F-4 PN/DPSIMATIC S7-1500 CPU 1518-4 PN/DP MFPSIPLUS ET 200SP CPU 1510SP-1 PNSIPLUS S7-1500 CPU 1516F-3 PN/DPSIMATIC S7-1500 CPU 1516T-3 PN/DPSIMATIC S7-1500 CPU 1518TF-4 PN/DPSIPLUS S7-1500 CPU 1515R-2 PN TX RAILSIMATIC S7-1500 CPU 1512SP-1 PNSIMATIC S7-1500 CPU 1518T-4 PN/DPSIMATIC S7-1500 CPU 1511-1 PNSIMATIC S7-1500 CPU 1517T-3 PN/DPSIPLUS S7-1500 CPU 1518HF-4 PNSIPLUS S7-1500 CPU 1513-1 PNSIPLUS S7-1500 CPU 1515R-2 PNSIMATIC S7-1500 CPU 1513F-1 PNSIMATIC S7-1500 CPU 1510SP F-1 PNSIPLUS S7-1500 CPU 1515F-2 PN RAILSIPLUS TIM 1531 IRCSIMATIC S7-1500 CPU 1511F-1 PNSIMATIC S7-1500 CPU 1516F-3 PN/DPSIPLUS ET 200SP CPU 1512SP-1 PNSIPLUS S7-1500 CPU 1511-1 PN T1 RAILSIPLUS S7-1500 CPU 1511-1 PNSIPLUS S7-1500 CPU 1516F-3 PN/DP RAIL
CWE ID-CWE-1287
Improper Validation of Specified Type of Input
CWE ID-CWE-20
Improper Input Validation
CVE-2024-38230
Matching Score-4
Assigner-Microsoft Corporation
ShareView Details
Matching Score-4
Assigner-Microsoft Corporation
CVSS Score-6.5||MEDIUM
EPSS-7.13% / 91.74%
||
7 Day CHG~0.00%
Published-10 Sep, 2024 | 16:53
Updated-31 Dec, 2024 | 23:02
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Windows Standards-Based Storage Management Service Denial of Service Vulnerability

Windows Standards-Based Storage Management Service Denial of Service Vulnerability

Action-Not Available
Vendor-Microsoft Corporation
Product-windows_server_2012windows_server_2016windows_server_2019windows_server_2022Windows Server 2022Windows Server 2019 (Server Core installation)Windows Server 2012 R2Windows Server 2016 (Server Core installation)Windows Server 2019Windows Server 2012 R2 (Server Core installation)Windows Server 2016
CWE ID-CWE-20
Improper Input Validation
CVE-2024-37917
Matching Score-4
Assigner-MITRE Corporation
ShareView Details
Matching Score-4
Assigner-MITRE Corporation
CVSS Score-7.5||HIGH
EPSS-2.04% / 84.22%
||
7 Day CHG~0.00%
Published-02 Apr, 2025 | 00:00
Updated-18 Jun, 2025 | 13:57
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

Pexip Infinity before 35.0 has improper input validation that allows remote attackers to trigger a denial of service (software abort) via a crafted signalling message.

Action-Not Available
Vendor-pexipn/a
Product-pexip_infinityn/a
CWE ID-CWE-20
Improper Input Validation
CVE-2024-37794
Matching Score-4
Assigner-MITRE Corporation
ShareView Details
Matching Score-4
Assigner-MITRE Corporation
CVSS Score-7.5||HIGH
EPSS-0.19% / 40.76%
||
7 Day CHG~0.00%
Published-17 Jun, 2024 | 00:00
Updated-15 Apr, 2026 | 00:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

Improper input validation in CVC5 Solver v1.1.3 allows attackers to cause a Denial of Service (DoS) via a crafted SMT2 input file.

Action-Not Available
Vendor-n/acvc5
Product-n/acvc5
CWE ID-CWE-20
Improper Input Validation
CVE-2016-3706
Matching Score-4
Assigner-Red Hat, Inc.
ShareView Details
Matching Score-4
Assigner-Red Hat, Inc.
CVSS Score-7.5||HIGH
EPSS-2.48% / 85.61%
||
7 Day CHG~0.00%
Published-10 Jun, 2016 | 15:00
Updated-06 May, 2026 | 22:30
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

Stack-based buffer overflow in the getaddrinfo function in sysdeps/posix/getaddrinfo.c in the GNU C Library (aka glibc or libc6) allows remote attackers to cause a denial of service (crash) via vectors involving hostent conversion. NOTE: this vulnerability exists because of an incomplete fix for CVE-2013-4458.

Action-Not Available
Vendor-n/aopenSUSEGNU
Product-glibcopensusen/a
CWE ID-CWE-20
Improper Input Validation
CVE-2021-41772
Matching Score-4
Assigner-MITRE Corporation
ShareView Details
Matching Score-4
Assigner-MITRE Corporation
CVSS Score-7.5||HIGH
EPSS-0.06% / 19.64%
||
7 Day CHG~0.00%
Published-08 Nov, 2021 | 00:00
Updated-04 Aug, 2024 | 03:15
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

Go before 1.16.10 and 1.17.x before 1.17.3 allows an archive/zip Reader.Open panic via a crafted ZIP archive containing an invalid name or an empty filename field.

Action-Not Available
Vendor-n/aOracle CorporationFedora ProjectGo
Product-gofedoratimesten_in-memory_databasen/a
CWE ID-CWE-20
Improper Input Validation
  • Previous
  • 1
  • 2
  • 3
  • ...
  • 15
  • 16
  • Next
Details not found