Logo
-

Byte Open Security

(ByteOS Network)

Log In

Sign Up

ByteOS

Security
Vulnerability Details
Registries
Custom Views
Weaknesses
Attack Patterns
Filters & Tools
Vulnerability Details :

CVE-2026-47244

Summary
Assigner-GitHub_M
Assigner Org ID-a0819718-46f1-4df5-94e2-005712e83aaa
Published At-12 Jun, 2026 | 14:23
Updated At-12 Jun, 2026 | 14:59
Rejected At-
Credits

Netty HTTP/2: Advertised MAX_CONCURRENT_STREAMS are not enforced

Netty is a network application framework for development of protocol servers and clients. Prior to versions 4.1.135.Final and 4.2.15.Final, DefaultHttp2Connection.DefaultEndpoint initialises maxActiveStreams/maxStreams to Integer.MAX_VALUE, and Http2Settings never inserts SETTINGS_MAX_CONCURRENT_STREAMS by default (Http2Settings.java:305-307 only clamps a user-supplied value). Unless the application explicitly calls initialSettings().maxConcurrentStreams(n), a Netty HTTP/2 server advertises no limit and enforces none locally. Each open stream allocates a DefaultStream object, PropertyMap slots, flow-controller state and IntObjectHashMap entry; with ~2^30 permissible odd stream IDs a single TCP connection can create hundreds of thousands of long-lived stream objects. This is also the precondition for CVE-2023-44487-style Rapid-Reset amplification, where the absence of a low concurrent cap multiplies backend work. Versions 4.1.135.Final and 4.2.15.Final patch the issue.

Vendors
-
Not available
Products
-
Metrics (CVSS)
VersionBase scoreBase severityVector
Weaknesses
Attack Patterns
Solution/Workaround
References
HyperlinkResource Type
EPSS History
Score
Latest Score
-
N/A
No data available for selected date range
Percentile
Latest Percentile
-
N/A
No data available for selected date range
Stakeholder-Specific Vulnerability Categorization (SSVC)
▼Common Vulnerabilities and Exposures (CVE)
cve.org
Assigner:GitHub_M
Assigner Org ID:a0819718-46f1-4df5-94e2-005712e83aaa
Published At:12 Jun, 2026 | 14:23
Updated At:12 Jun, 2026 | 14:59
Rejected At:
▼CVE Numbering Authority (CNA)
Netty HTTP/2: Advertised MAX_CONCURRENT_STREAMS are not enforced

Netty is a network application framework for development of protocol servers and clients. Prior to versions 4.1.135.Final and 4.2.15.Final, DefaultHttp2Connection.DefaultEndpoint initialises maxActiveStreams/maxStreams to Integer.MAX_VALUE, and Http2Settings never inserts SETTINGS_MAX_CONCURRENT_STREAMS by default (Http2Settings.java:305-307 only clamps a user-supplied value). Unless the application explicitly calls initialSettings().maxConcurrentStreams(n), a Netty HTTP/2 server advertises no limit and enforces none locally. Each open stream allocates a DefaultStream object, PropertyMap slots, flow-controller state and IntObjectHashMap entry; with ~2^30 permissible odd stream IDs a single TCP connection can create hundreds of thousands of long-lived stream objects. This is also the precondition for CVE-2023-44487-style Rapid-Reset amplification, where the absence of a low concurrent cap multiplies backend work. Versions 4.1.135.Final and 4.2.15.Final patch the issue.

Affected Products
Vendor
The Netty Projectnetty
Product
netty
Versions
Affected
  • >= 4.2.0.Final, < 4.2.15.Final
  • < 4.1.135.Final
Problem Types
TypeCWE IDDescription
CWECWE-400CWE-400: Uncontrolled Resource Consumption
Type: CWE
CWE ID: CWE-400
Description: CWE-400: Uncontrolled Resource Consumption
Metrics
VersionBase scoreBase severityVector
3.15.3MEDIUM
CVSS:3.1/AV:N/AC:L/PR:N/UI:N/S:U/C:N/I:N/A:L
Version: 3.1
Base score: 5.3
Base severity: MEDIUM
Vector:
CVSS:3.1/AV:N/AC:L/PR:N/UI:N/S:U/C:N/I:N/A:L
Metrics Other Info
Impacts
CAPEC IDDescription
Solutions

Configurations

Workarounds

Exploits

Credits

Timeline
EventDate
Replaced By

Rejected Reason

References
HyperlinkResource
https://github.com/netty/netty/security/advisories/GHSA-5x3r-wrvg-rp6q
x_refsource_CONFIRM
https://github.com/netty/netty/releases/tag/netty-4.1.135.Final
x_refsource_MISC
https://github.com/netty/netty/releases/tag/netty-4.2.15.Final
x_refsource_MISC
Hyperlink: https://github.com/netty/netty/security/advisories/GHSA-5x3r-wrvg-rp6q
Resource:
x_refsource_CONFIRM
Hyperlink: https://github.com/netty/netty/releases/tag/netty-4.1.135.Final
Resource:
x_refsource_MISC
Hyperlink: https://github.com/netty/netty/releases/tag/netty-4.2.15.Final
Resource:
x_refsource_MISC
▼Authorized Data Publishers (ADP)
CISA ADP Vulnrichment
Affected Products
Metrics
VersionBase scoreBase severityVector
Metrics Other Info
Impacts
CAPEC IDDescription
Solutions

Configurations

Workarounds

Exploits

Credits

Timeline
EventDate
Replaced By

Rejected Reason

References
HyperlinkResource
Information is not available yet
▼National Vulnerability Database (NVD)
nvd.nist.gov
Source:security-advisories@github.com
Published At:12 Jun, 2026 | 15:16
Updated At:12 Jun, 2026 | 15:55

Netty is a network application framework for development of protocol servers and clients. Prior to versions 4.1.135.Final and 4.2.15.Final, DefaultHttp2Connection.DefaultEndpoint initialises maxActiveStreams/maxStreams to Integer.MAX_VALUE, and Http2Settings never inserts SETTINGS_MAX_CONCURRENT_STREAMS by default (Http2Settings.java:305-307 only clamps a user-supplied value). Unless the application explicitly calls initialSettings().maxConcurrentStreams(n), a Netty HTTP/2 server advertises no limit and enforces none locally. Each open stream allocates a DefaultStream object, PropertyMap slots, flow-controller state and IntObjectHashMap entry; with ~2^30 permissible odd stream IDs a single TCP connection can create hundreds of thousands of long-lived stream objects. This is also the precondition for CVE-2023-44487-style Rapid-Reset amplification, where the absence of a low concurrent cap multiplies backend work. Versions 4.1.135.Final and 4.2.15.Final patch the issue.

CISA Catalog
Date AddedDue DateVulnerability NameRequired Action
N/A
Date Added: N/A
Due Date: N/A
Vulnerability Name: N/A
Required Action: N/A
Metrics
TypeVersionBase scoreBase severityVector
Secondary3.15.3MEDIUM
CVSS:3.1/AV:N/AC:L/PR:N/UI:N/S:U/C:N/I:N/A:L
Type: Secondary
Version: 3.1
Base score: 5.3
Base severity: MEDIUM
Vector:
CVSS:3.1/AV:N/AC:L/PR:N/UI:N/S:U/C:N/I:N/A:L
CPE Matches

Weaknesses
CWE IDTypeSource
CWE-400Primarysecurity-advisories@github.com
CWE ID: CWE-400
Type: Primary
Source: security-advisories@github.com
Evaluator Description

Evaluator Impact

Evaluator Solution

Vendor Statements

References
HyperlinkSourceResource
https://github.com/netty/netty/releases/tag/netty-4.1.135.Finalsecurity-advisories@github.com
N/A
https://github.com/netty/netty/releases/tag/netty-4.2.15.Finalsecurity-advisories@github.com
N/A
https://github.com/netty/netty/security/advisories/GHSA-5x3r-wrvg-rp6qsecurity-advisories@github.com
N/A
Hyperlink: https://github.com/netty/netty/releases/tag/netty-4.1.135.Final
Source: security-advisories@github.com
Resource: N/A
Hyperlink: https://github.com/netty/netty/releases/tag/netty-4.2.15.Final
Source: security-advisories@github.com
Resource: N/A
Hyperlink: https://github.com/netty/netty/security/advisories/GHSA-5x3r-wrvg-rp6q
Source: security-advisories@github.com
Resource: N/A

Change History

0
Information is not available yet

Similar CVEs

213Records found

CVE-2026-48043
Matching Score-10
Assigner-GitHub, Inc.
ShareView Details
Matching Score-10
Assigner-GitHub, Inc.
CVSS Score-5.3||MEDIUM
EPSS-Not Assigned
Published-12 Jun, 2026 | 14:39
Updated-12 Jun, 2026 | 16:18
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
netty-codec-http2: ByteBuf Reference-Count Leak in DelegatingDecompressorFrameListener Leads to Memory Exhaustion

Netty is a network application framework for development of protocol servers and clients. In netty-codec-http2 prior to versions 4.1.135.Final and 4.2.15.Final, the `DelegatingDecompressorFrameListener` class orchestrates HTTP/2 decompression by embedding a per-stream `EmbeddedChannel` that runs the appropriate decompression codec (gzip, deflate, zstd) and forwards decompressed chunks to a wrapped listener. Each decompressed chunk is a pooled `ByteBuf` handed to an anonymous `ChannelInboundHandlerAdapter` tail handler, which becomes the sole owner responsible for releasing it. A remote peer could send frames that would result in the flow-controller throwing and so trigger a resource leak which at the end might take down the whole JVM due OOME. Versions 4.1.135.Final and 4.2.15.Final patch the issue.

Action-Not Available
Vendor-The Netty Project
Product-netty
CWE ID-CWE-400
Uncontrolled Resource Consumption
CWE ID-CWE-401
Missing Release of Memory after Effective Lifetime
CVE-2026-44248
Matching Score-10
Assigner-GitHub, Inc.
ShareView Details
Matching Score-10
Assigner-GitHub, Inc.
CVSS Score-5.3||MEDIUM
EPSS-0.02% / 4.85%
||
7 Day CHG~0.00%
Published-13 May, 2026 | 18:23
Updated-18 May, 2026 | 12:15
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty: Resource exhaustion in MqttDecoder

Netty is an asynchronous, event-driven network application framework. Prior to 4.2.13.Final and 4.1.133.Final, the MQTT 5 header Properties section is parsed and buffered before any message size limit is applied. Specifically, in MqttDecoder, the decodeVariableHeader() method is called before the bytesRemainingBeforeVariableHeader > maxBytesInMessage check. The decodeVariableHeader() can call other methods which will call decodeProperties(). Effectively, Netty does not apply any limits to the size of the properties being decoded. Additionally, because MqttDecoder extends ReplayingDecoder, Netty will repeatedly re-parse the enormous Properties sections and buffer the bytes in memory, until the entire thing parses to completion. This can cause high resource usage in both CPU and memory. This vulnerability is fixed in 4.2.13.Final and 4.1.133.Final.

Action-Not Available
Vendor-io.nettyThe Netty Project
Product-nettynetty-codec-mqttnetty
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2024-29025
Matching Score-8
Assigner-GitHub, Inc.
ShareView Details
Matching Score-8
Assigner-GitHub, Inc.
CVSS Score-5.3||MEDIUM
EPSS-0.34% / 57.29%
||
7 Day CHG~0.00%
Published-25 Mar, 2024 | 20:09
Updated-19 Sep, 2025 | 15:10
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty HttpPostRequestDecoder can OOM

Netty is an asynchronous event-driven network application framework for rapid development of maintainable high performance protocol servers & clients. The `HttpPostRequestDecoder` can be tricked to accumulate data. While the decoder can store items on the disk if configured so, there are no limits to the number of fields the form can have, an attacher can send a chunked post consisting of many small fields that will be accumulated in the `bodyListHttpData` list. The decoder cumulates bytes in the `undecodedChunk` buffer until it can decode a field, this field can cumulate data without limits. This vulnerability is fixed in 4.1.108.Final.

Action-Not Available
Vendor-The Netty ProjectDebian GNU/Linux
Product-debian_linuxnettynettynetty
CWE ID-CWE-770
Allocation of Resources Without Limits or Throttling
CVE-2025-29908
Matching Score-8
Assigner-GitHub, Inc.
ShareView Details
Matching Score-8
Assigner-GitHub, Inc.
CVSS Score-5.3||MEDIUM
EPSS-0.39% / 60.67%
||
7 Day CHG~0.00%
Published-31 Mar, 2025 | 18:43
Updated-15 Apr, 2026 | 00:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty QUIC hash collision DoS attack

Netty QUIC codec is a QUIC codec for netty which makes use of quiche. An issue was discovered in the codec. A hash collision vulnerability (in the hash map used to manage connections) allows remote attackers to cause a considerable CPU load on the server (a Hash DoS attack) by initiating connections with colliding Source Connection IDs (SCIDs). This vulnerability is fixed in 0.0.71.Final.

Action-Not Available
Vendor-The Netty Project
Product-netty-incubator-codec-quic
CWE ID-CWE-407
Inefficient Algorithmic Complexity
CVE-2022-41881
Matching Score-8
Assigner-GitHub, Inc.
ShareView Details
Matching Score-8
Assigner-GitHub, Inc.
CVSS Score-5.3||MEDIUM
EPSS-0.47% / 65.12%
||
7 Day CHG+0.02%
Published-12 Dec, 2022 | 00:00
Updated-22 Apr, 2025 | 15:57
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

Netty project is an event-driven asynchronous network application framework. In versions prior to 4.1.86.Final, a StackOverflowError can be raised when parsing a malformed crafted message due to an infinite recursion. This issue is patched in version 4.1.86.Final. There is no workaround, except using a custom HaProxyMessageDecoder.

Action-Not Available
Vendor-Debian GNU/LinuxThe Netty Project
Product-nettydebian_linuxnetty
CWE ID-CWE-674
Uncontrolled Recursion
CVE-2026-44892
Matching Score-6
Assigner-GitHub, Inc.
ShareView Details
Matching Score-6
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-Not Assigned
Published-12 Jun, 2026 | 05:04
Updated-12 Jun, 2026 | 09:59
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty has a Vulnerable Default Configuration Which Leads to Denial of Service via Unbounded HTTP/3 Header Size

Netty is a network application framework for development of protocol servers and clients. Prior to version 4.2.15.Final, the default configuration of the `Http3ConnectionHandler` in the Netty HTTP/3 codec lacks an enforced maximum header size limit. When a peer does not explicitly specify `HTTP3_SETTINGS_MAX_FIELD_SECTION_SIZE`, the implementation defaults to an unbounded limit. This insecure default configuration allows a malicious client or server to send an enormous number of headers, leading to a memory exhaustion Denial of Service via an `OutOfMemoryError`. Version 4.2.15.Final contains a patch.

Action-Not Available
Vendor-The Netty Project
Product-netty
CWE ID-CWE-1188
Initialization of a Resource with an Insecure Default
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2026-50011
Matching Score-6
Assigner-GitHub, Inc.
ShareView Details
Matching Score-6
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-Not Assigned
Published-12 Jun, 2026 | 14:52
Updated-12 Jun, 2026 | 16:18
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty has unbounded pre-allocation in RedisArrayAggregator from RESP array length

Netty is a network application framework for development of protocol servers and clients. Prior to versions 4.1.135.Final and 4.2.15.Final, RedisArrayAggregator pre-allocates ArrayList with initial capacity equal to the RESP array element count declared in an array header. That count is taken from the wire before the corresponding child messages exist. A small malicious header can claim a huge initial capacity. Versions 4.1.135.Final and 4.2.15.Final patch the issue.

Action-Not Available
Vendor-The Netty Project
Product-netty
CWE ID-CWE-400
Uncontrolled Resource Consumption
CWE ID-CWE-770
Allocation of Resources Without Limits or Throttling
CVE-2026-44250
Matching Score-6
Assigner-GitHub, Inc.
ShareView Details
Matching Score-6
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-Not Assigned
Published-11 Jun, 2026 | 20:49
Updated-12 Jun, 2026 | 13:44
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty: Memory Exhaustion in RedisArrayAggregator due to Deeply Nested Arrays

Netty is a network application framework for development of protocol servers and clients. In netty-codec-redis prior to versions 4.1.135.Final and 4.2.15.Final, an attacker can cause DoS by sending a crafted Redis payload with deeply nested arrays. This forces the server to allocate a massive number of state objects and collections, leading to memory exhaustion and an OutOfMemoryError. Versions 4.1.135.Final and 4.2.15.Final patch the issue.

Action-Not Available
Vendor-The Netty Project
Product-netty
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2026-44890
Matching Score-6
Assigner-GitHub, Inc.
ShareView Details
Matching Score-6
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-Not Assigned
Published-11 Jun, 2026 | 20:52
Updated-12 Jun, 2026 | 10:05
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty has Unbounded Direct Memory Consumption in its RedisDecoder

Netty is a network application framework for development of protocol servers and clients. In netty-codec-redis prior to versions 4.1.135.Final and 4.2.15.Final, an attacker can cause DoS by sending crafted Redis payloads across multiple connections without `\r\n`. This exhausts the server's direct memory pool (OutOfDirectMemoryError), preventing legitimate connections from being processed. Versions 4.1.135.Final and 4.2.15.Final patch the issue.

Action-Not Available
Vendor-The Netty Project
Product-netty
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2026-42579
Matching Score-6
Assigner-GitHub, Inc.
ShareView Details
Matching Score-6
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-0.03% / 9.79%
||
7 Day CHG~0.00%
Published-13 May, 2026 | 18:01
Updated-18 May, 2026 | 17:16
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty: DNS Codec Input Validation Bypass in Netty (Encoder + Decoder)

Netty is an asynchronous, event-driven network application framework. Prior to 4.2.13.Final and 4.1.133.Final, Netty's DNS codec does not enforce RFC 1035 domain name constraints during either encoding or decoding. This creates a bidirectional attack surface: malicious DNS responses can exploit the decoder, and user-influenced hostnames can exploit the encoder. This vulnerability is fixed in 4.2.13.Final and 4.1.133.Final.

Action-Not Available
Vendor-The Netty Project
Product-nettynetty
CWE ID-CWE-20
Improper Input Validation
CWE ID-CWE-400
Uncontrolled Resource Consumption
CWE ID-CWE-626
Null Byte Interaction Error (Poison Null Byte)
CVE-2026-42583
Matching Score-6
Assigner-GitHub, Inc.
ShareView Details
Matching Score-6
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-0.02% / 4.32%
||
7 Day CHG~0.00%
Published-13 May, 2026 | 18:09
Updated-18 May, 2026 | 12:22
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty: Lz4FrameDecoder resource exhaustion

Netty is an asynchronous, event-driven network application framework. Prior to 4.2.13.Final and 4.1.133.Final, Lz4FrameDecoder allocates a ByteBuf of size decompressedLength (up to 32 MB per block) before LZ4 runs. A peer only needs a 21-byte header plus compressedLength payload bytes - 22 bytes if compressedLength == 1 - to force that allocation. This vulnerability is fixed in 4.2.13.Final and 4.1.133.Final.

Action-Not Available
Vendor-io.nettyThe Netty Project
Product-nettynetty-codec-compressionnettynetty-codec
CWE ID-CWE-400
Uncontrolled Resource Consumption
CWE ID-CWE-770
Allocation of Resources Without Limits or Throttling
CVE-2026-42587
Matching Score-6
Assigner-GitHub, Inc.
ShareView Details
Matching Score-6
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-0.02% / 4.78%
||
7 Day CHG~0.00%
Published-13 May, 2026 | 18:22
Updated-18 May, 2026 | 12:20
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty: HttpContentDecompressor maxAllocation bypass via Content-Encoding: br/zstd/snappy enables decompression bomb DoS

Netty is an asynchronous, event-driven network application framework. Prior to 4.2.13.Final and 4.1.133.Final, HttpContentDecompressor accepts a maxAllocation parameter to limit decompression buffer size and prevent decompression bomb attacks. This limit is correctly enforced for gzip and deflate encodings via ZlibDecoder, but is silently ignored when the content encoding is br (Brotli), zstd, or snappy. An attacker can bypass the configured decompression limit by sending a compressed payload with Content-Encoding: br instead of Content-Encoding: gzip, causing unbounded memory allocation and out-of-memory denial of service. The same vulnerability exists in DelegatingDecompressorFrameListener for HTTP/2 connections. This vulnerability is fixed in 4.2.13.Final and 4.1.133.Final.

Action-Not Available
Vendor-io.nettyThe Netty Project
Product-nettynetty-codec-httpnettynetty-codec-http2
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2025-25193
Matching Score-6
Assigner-GitHub, Inc.
ShareView Details
Matching Score-6
Assigner-GitHub, Inc.
CVSS Score-5.5||MEDIUM
EPSS-0.10% / 26.48%
||
7 Day CHG~0.00%
Published-10 Feb, 2025 | 22:02
Updated-11 Jun, 2025 | 15:36
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Denial of Service attack on windows app using Netty

Netty, an asynchronous, event-driven network application framework, has a vulnerability in versions up to and including 4.1.118.Final. An unsafe reading of environment file could potentially cause a denial of service in Netty. When loaded on an Windows application, Netty attempts to load a file that does not exist. If an attacker creates such a large file, the Netty application crash. A similar issue was previously reported as CVE-2024-47535. This issue was fixed, but the fix was incomplete in that null-bytes were not counted against the input limit. Commit d1fbda62d3a47835d3fb35db8bd42ecc205a5386 contains an updated fix.

Action-Not Available
Vendor-The Netty ProjectMicrosoft Corporation
Product-nettywindowsnetty
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2023-44487
Matching Score-6
Assigner-MITRE Corporation
ShareView Details
Matching Score-6
Assigner-MITRE Corporation
CVSS Score-7.5||HIGH
EPSS-94.39% / 99.97%
||
7 Day CHG-0.01%
Published-10 Oct, 2023 | 00:00
Updated-12 May, 2026 | 15:10
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Known KEV||Action Due Date - 2023-10-31||Apply mitigations per vendor instructions, follow applicable BOD 22-01 guidance for cloud services, or discontinue use of the product if mitigations are unavailable.

The HTTP/2 protocol allows a denial of service (server resource consumption) because request cancellation can reset many streams quickly, as exploited in the wild in August through October 2023.

Action-Not Available
Vendor-varnish_cache_projectamazonlinkerdakkatraefikcaddyserverprojectcontourdenagrpcistioenvoyproxykonghqlinecorpkazu-yamamotonghttp2openrestyn/aRed Hat, Inc.NetApp, Inc.Siemens AGGoF5, Inc.The Netty ProjectThe Apache Software FoundationMicrosoft CorporationApple Inc.Eclipse Foundation AISBLCisco Systems, Inc.Fedora ProjectDebian GNU/LinuxThe IETF Administration LLC (IETF LLC)FacebookNode.js (OpenJS Foundation)Jenkins
Product-nexus_9804nexus_9332d-h2rnexus_9372txnexus_9200istionexus_92160yc_switchfedoranexus_92160yc-xsiplus_s7-1500_cpu_1518-4_pn\/dp_mfp_firmwareenterprise_chat_and_email.netvisual_studio_2022windows_10_22h2node_healthcheck_operatornexus_36180yc-ropenshift_sandboxed_containersnexus_9500_4-slotnexus_93128tx_switchnexus_92300ycbig-ip_nextcost_managementjboss_enterprise_application_platformnexus_9200ycnexus_9332pqnexus_9396txproxygenultra_cloud_core_-_session_management_functionintegration_camel_kintegration_camel_for_spring_bootnexus_3064tazure_kubernetes_servicenexus_93180yc-fxcrosswork_zero_touch_provisioningbig-ip_analyticsnexus_3432d-snexus_93180yc-fx3secure_malware_analyticsopensearch_data_preppersecure_web_appliance_firmwareweb_terminalprime_infrastructurenexus_93180lc-ex_switchopenshift_container_platform_assisted_installercertification_for_red_hat_enterprise_linuxprime_cable_provisioningnexus_93108tc-fx-24connected_mobile_experiencesnexus_92300yc_switchprocess_automationexpresswayhttp_serverunified_attendant_console_advancedopenstack_platformnginx_plusnexus_93240yc-fx2nexus_3636c-rcryostatnexus_3100-zsingle_sign-onopenshift_distributed_tracingnexus_9736pqnexus_9272qnexus_3016qnexus_93108tc-ex-24unified_contact_center_domain_managernexus_9396tx_switchopenshift_developer_tools_and_servicesnexus_93128crosswork_situation_managernexus_93180yc-ex-24nexus_9332pq_switchwindows_server_2022nexus_31108pc-vopenshift_api_for_data_protectionopenshift_gitopsnexus_3132c-zsupport_for_spring_bootwindows_server_2016nexus_3016nexus_3132q-vopenshift_service_mesh3scale_api_management_platformnexus_3464cnexus_9500ropenshiftcaddynexus_3100-vnexus_3132qopenshift_secondary_scheduler_operatornexus_3064-32tnexus_31108tc-varmeriagomigration_toolkit_for_containersbuild_of_optaplannernexus_3232nexus_9372pxbig-ip_websafenexus_9500_supervisor_anexus_9348gc-fxpultra_cloud_core_-_serving_gateway_functionnexus_3172tqnexus_9504windows_10_21h2nexus_3064xnexus_3232cnexus_9636pqnexus_3400jettyansible_automation_platformnexus_9500_supervisor_bnexus_9372tx-ewindows_10_1809nexus_3524-xlnexus_3408-snexus_3172tq-32tnexus_93180tc-exnexus_9516nexus_3524-xnexus_3264c-enexus_3172pqnexus_3172pq\/pq-xlnexus_9336pqastra_control_centernexus_9364c-gxnexus_9336c-fx2simatic_s7-1500_cpu_1518-4_pn\/dpnexus_9236cnexus_9536pqnexus_9236c_switchnexus_93180yc-fx-24nexus_31128pqnetwork_observability_operatorbig-ip_application_security_managerprime_access_registrarswiftnio_http\/2linkerdios_xewindows_11_22h2nexus_9500_supervisor_b\+nexus_9364d-gx2adecision_managerbig-ip_policy_enforcement_managerquaynexus_3264qbusiness_process_automationnexus_3100vsecure_dynamic_attributes_connectornexus_9372tx_switchnexus_9500_supervisor_a\+machine_deletion_remediation_operatornode.jssatellitenexus_9348d-gx2abig-ip_domain_name_systemnexus_3064nexus_9372px-e_switchbig-ip_link_controllernexus_93108tc-ex_switchhttpbig-ip_advanced_firewall_managerprime_network_registrarcert-manager_operator_for_red_hat_openshiftnexus_9432pqtraefikbuild_of_quarkusnexus_3524self_node_remediation_operatorcrosswork_data_gatewaycontournode_maintenance_operatorcbl-marinernexus_9716d-gxsinec_insh2onexus_9332d-gx2bnexus_9372px_switchapisixjboss_core_servicesnexus_9500_16-slotsimatic_s7-1500_cpu_1518-4_pn\/dp_mfp_firmwareoncommand_insightnexus_9372px-enexus_9336pq_aci_spinenexus_3548-xnexus_9221cnexus_9272q_switchnexus_93108tc-fxfirepower_threat_defensebig-ip_fraud_protection_servicewindows_server_2019migration_toolkit_for_virtualizationvarnish_cacheunified_contact_center_enterprisenexus_93108tc-fx3hnexus_93240tc-fx2asp.net_coretelepresence_video_communication_servernexus_93216tc-fx2nexus_3100traffic_servernexus_3064-xnexus_9348gc-fx3nexus_9332cbig-ip_application_visibility_and_reportingnexus_3132q-x\/3132q-xltomcatwindows_10_1607simatic_s7-1500_cpu_1518f-4_pn\/dp_mfp_firmwarenexus_3172tq-xlnexus_3548-xlnexus_9336pq_aci_spine_switchsiplus_s7-1500_cpu_1518-4_pn\/dp_mfpnexus_3164qdebian_linuxnexus_9396px_switchnexus_9396pxlogging_subsystem_for_red_hat_openshiftnexus_9364cbig-ip_webacceleratoropenshift_serverlessnetworkingnexus_9500big-ip_ssl_orchestratornexus_93180yc-ex_switchnexus_9508nexus_3132q-xnexus_93120txnexus_3132q-xlnexus_9408ruggedcom_ape1808_firmwarenexus_34180ycnexus_93180yc-fx3snx-osnexus_93180lc-exunified_contact_center_management_portalnexus_92304qc_switchdata_center_network_manageropenrestynexus_92348gc-xbig-ip_application_acceleration_manageropenshift_virtualizationnexus_93108tc-fx3pnexus_93360yc-fx2nexus_3172pq-xlnexus_31108pv-vgrpcnexus_93128txnexus_3064-tadvanced_cluster_management_for_kubernetesbig-ip_advanced_web_application_firewallenvoynexus_3232c_big-ip_global_traffic_managernginxfence_agents_remediation_operatorjboss_data_gridios_xrfog_directorsimatic_s7-1500_cpu_1518f-4_pn\/dp_mfpbig-ip_carrier-grade_natnexus_9300windows_11_21h2secure_web_applianceintegration_service_registryhttp2openshift_dev_spacesbig-ip_ddos_hybrid_defendernexus_93180yc-fx3hservice_interconnectnghttp2openshift_data_sciencest7_scadaconnectnexus_93120tx_switchbig-ip_local_traffic_managerbig-ip_access_policy_managerjboss_fuseopenshift_container_platformopenshift_pipelinesnexus_3048nexus_9508_switchnettynexus_9336c-fx2-enexus_93600cd-gxnexus_34200yc-smnexus_9516_switchceph_storagenexus_3600jboss_a-mqrun_once_duration_override_operatornexus_9000vnexus_3172nexus_3500sinec_nmsruggedcom_ape1808nexus_9336pq_acinexus_9316d-gxnexus_9800kong_gatewayadvanced_cluster_securitynexus_3548-x\/xlunified_contact_center_enterprise_-_live_data_serverultra_cloud_core_-_policy_control_functionbig-ip_next_service_proxy_for_kubernetesnexus_9232enexus_9808jboss_a-mq_streamsnexus_92304qciot_field_network_directornexus_9500_8-slotmigration_toolkit_for_applicationsnexus_3200solrjenkinsnginx_ingress_controllernexus_93180yc-exnexus_9372tx-e_switchnexus_93108tc-exnexus_9504_switchnexus_3524-x\/xlnexus_3548service_telemetry_frameworkenterprise_linuxn/aRUGGEDCOM APE1808SINEC NMSSIPLUS S7-1500 CPU 1518-4 PN/DP MFPSIMATIC S7-1500 CPU 1518F-4 PN/DP MFPSIMATIC S7-1500 CPU 1518-4 PN/DP MFPhttpHTTP/2
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2023-34462
Matching Score-6
Assigner-GitHub, Inc.
ShareView Details
Matching Score-6
Assigner-GitHub, Inc.
CVSS Score-6.5||MEDIUM
EPSS-0.74% / 73.28%
||
7 Day CHG~0.00%
Published-22 Jun, 2023 | 23:00
Updated-13 Feb, 2025 | 16:55
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
netty-handler SniHandler 16MB allocation

Netty is an asynchronous event-driven network application framework for rapid development of maintainable high performance protocol servers & clients. The `SniHandler` can allocate up to 16MB of heap for each channel during the TLS handshake. When the handler or the channel does not have an idle timeout, it can be used to make a TCP server using the `SniHandler` to allocate 16MB of heap. The `SniHandler` class is a handler that waits for the TLS handshake to configure a `SslHandler` according to the indicated server name by the `ClientHello` record. For this matter it allocates a `ByteBuf` using the value defined in the `ClientHello` record. Normally the value of the packet should be smaller than the handshake packet but there are not checks done here and the way the code is written, it is possible to craft a packet that makes the `SslClientHelloHandler`. This vulnerability has been fixed in version 4.1.94.Final.

Action-Not Available
Vendor-The Netty Project
Product-nettynetty
CWE ID-CWE-400
Uncontrolled Resource Consumption
CWE ID-CWE-770
Allocation of Resources Without Limits or Throttling
CVE-2024-47535
Matching Score-6
Assigner-GitHub, Inc.
ShareView Details
Matching Score-6
Assigner-GitHub, Inc.
CVSS Score-5.5||MEDIUM
EPSS-0.47% / 64.91%
||
7 Day CHG~0.00%
Published-12 Nov, 2024 | 15:50
Updated-05 Sep, 2025 | 14:00
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Denial of Service attack on windows app using Netty

Netty is an asynchronous event-driven network application framework for rapid development of maintainable high performance protocol servers & clients. An unsafe reading of environment file could potentially cause a denial of service in Netty. When loaded on an Windows application, Netty attempts to load a file that does not exist. If an attacker creates such a large file, the Netty application crashes. This vulnerability is fixed in 4.1.115.

Action-Not Available
Vendor-The Netty ProjectMicrosoft Corporation
Product-nettywindowsnettynetty
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2021-37137
Matching Score-6
Assigner-JFrog
ShareView Details
Matching Score-6
Assigner-JFrog
CVSS Score-7.5||HIGH
EPSS-2.38% / 85.34%
||
7 Day CHG~0.00%
Published-19 Oct, 2021 | 00:00
Updated-04 Aug, 2024 | 01:16
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

The Snappy frame decoder function doesn't restrict the chunk length which may lead to excessive memory usage. Beside this it also may buffer reserved skippable chunks until the whole chunk was received which may lead to excessive memory usage as well. This vulnerability can be triggered by supplying malicious input that decompresses to a very big size (via a network stream or a file) or by sending a huge skippable chunk.

Action-Not Available
Vendor-quarkusThe Netty ProjectNetApp, Inc.Debian GNU/LinuxOracle Corporation
Product-communications_diameter_signaling_routerbanking_apispeoplesoft_enterprise_peopletoolsdebian_linuxbanking_digital_experiencequarkusnettycommunications_cloud_native_core_binding_support_functioncommerce_guided_searchcommunications_brm_-_elastic_charging_enginewebcenter_portaloncommand_insightNetty
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2021-37136
Matching Score-6
Assigner-JFrog
ShareView Details
Matching Score-6
Assigner-JFrog
CVSS Score-7.5||HIGH
EPSS-1.19% / 79.22%
||
7 Day CHG~0.00%
Published-19 Oct, 2021 | 00:00
Updated-04 Aug, 2024 | 01:16
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

The Bzip2 decompression decoder function doesn't allow setting size restrictions on the decompressed output data (which affects the allocation size used during decompression). All users of Bzip2Decoder are affected. The malicious input can trigger an OOME and so a DoS attack

Action-Not Available
Vendor-quarkusThe Netty ProjectNetApp, Inc.Debian GNU/LinuxOracle Corporation
Product-communications_diameter_signaling_routercoherencepeoplesoft_enterprise_peopletoolscommunications_cloud_native_core_network_slice_selection_functionbanking_digital_experiencequarkuscommunications_cloud_native_core_security_edge_protection_proxyhelidoncommunications_instant_messaging_servercommunications_cloud_native_core_policycommunications_brm_-_elastic_charging_enginebanking_apisdebian_linuxcommunications_cloud_native_core_unified_data_repositorynettycommunications_cloud_native_core_binding_support_functioncommerce_guided_searchwebcenter_portaloncommand_insightNetty
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2025-59139
Matching Score-4
Assigner-GitHub, Inc.
ShareView Details
Matching Score-4
Assigner-GitHub, Inc.
CVSS Score-5.3||MEDIUM
EPSS-0.04% / 13.89%
||
7 Day CHG-0.01%
Published-12 Sep, 2025 | 13:03
Updated-17 Sep, 2025 | 20:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Hono has Body Limit Middleware Bypass

Hono is a Web application framework that provides support for any JavaScript runtime. In versions prior to 4.9.7, a flaw in the `bodyLimit` middleware could allow bypassing the configured request body size limit when conflicting HTTP headers were present. The middleware previously prioritized the `Content-Length` header even when a `Transfer-Encoding: chunked` header was also included. According to the HTTP specification, `Content-Length` must be ignored in such cases. This discrepancy could allow oversized request bodies to bypass the configured limit. Most standards-compliant runtimes and reverse proxies may reject such malformed requests with `400 Bad Request`, so the practical impact depends on the runtime and deployment environment. If body size limits are used as a safeguard against large or malicious requests, this flaw could allow attackers to send oversized request bodies. The primary risk is denial of service (DoS) due to excessive memory or CPU consumption when handling very large requests. The implementation has been updated to align with the HTTP specification, ensuring that `Transfer-Encoding` takes precedence over `Content-Length`. The issue is fixed in Hono v4.9.7, and all users should upgrade immediately.

Action-Not Available
Vendor-honohonojs
Product-honohono
CWE ID-CWE-400
Uncontrolled Resource Consumption
CWE ID-CWE-770
Allocation of Resources Without Limits or Throttling
CVE-2025-5891
Matching Score-4
Assigner-VulDB
ShareView Details
Matching Score-4
Assigner-VulDB
CVSS Score-5.3||MEDIUM
EPSS-0.37% / 59.04%
||
7 Day CHG~0.00%
Published-09 Jun, 2025 | 19:00
Updated-10 Jul, 2025 | 16:24
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Unitech pm2 Config.js redos

A vulnerability classified as problematic was found in Unitech pm2 up to 6.0.6. This vulnerability affects unknown code of the file /lib/tools/Config.js. The manipulation leads to inefficient regular expression complexity. The attack can be initiated remotely. The exploit has been disclosed to the public and may be used.

Action-Not Available
Vendor-keymetricUnitech
Product-pm2pm2
CWE ID-CWE-1333
Inefficient Regular Expression Complexity
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2025-58369
Matching Score-4
Assigner-GitHub, Inc.
ShareView Details
Matching Score-4
Assigner-GitHub, Inc.
CVSS Score-5.3||MEDIUM
EPSS-0.21% / 43.18%
||
7 Day CHG~0.00%
Published-05 Sep, 2025 | 21:59
Updated-07 Nov, 2025 | 12:15
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
fs2: Half-shutdown of socket during TLS handshake may result in spin loop on opposite side

fs2 is a compositional, streaming I/O library for Scala. Versions up to and including 2.5.12, 3.0.0-M1 through 3.12.2, and 3.13.0-M1 through 3.13.0-M6 are vulnerable to denial of service attacks though TLS sessions using fs2-io on the JVM using the fs2.io.net.tls package. When establishing a TLS session, if one side of the connection shuts down `write` while the peer side is awaiting more data to progress the TLS handshake, the peer side will spin loop on the socket read, fully utilizing a CPU. The CPU is consumed until the overall connection is closed, potentially shutting down a fs2-io powered server. This issue is fixed in versions 2.5.13, 3.12.1, and 3.13.0-M7.

Action-Not Available
Vendor-typelevel
Product-fs2
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2021-43838
Matching Score-4
Assigner-GitHub, Inc.
ShareView Details
Matching Score-4
Assigner-GitHub, Inc.
CVSS Score-5.3||MEDIUM
EPSS-0.33% / 56.67%
||
7 Day CHG~0.00%
Published-17 Dec, 2021 | 18:20
Updated-04 Aug, 2024 | 04:10
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Regular Expression Denial of Service (ReDoS) in jsx-slack

jsx-slack is a library for building JSON objects for Slack Block Kit surfaces from JSX. In versions prior to 4.5.1 users are vulnerable to a regular expression denial-of-service (ReDoS) attack. If attacker can put a lot of JSX elements into `<blockquote>` tag, an internal regular expression for escaping characters may consume an excessive amount of computing resources. jsx-slack v4.5.1 has patched to a regex for escaping blockquote characters. Users are advised to upgrade as soon as possible.

Action-Not Available
Vendor-jsx-slack_projectyhatt
Product-jsx-slackjsx-slack
CWE ID-CWE-400
Uncontrolled Resource Consumption
CWE ID-CWE-1333
Inefficient Regular Expression Complexity
CVE-2024-38809
Matching Score-4
Assigner-VMware by Broadcom
ShareView Details
Matching Score-4
Assigner-VMware by Broadcom
CVSS Score-5.3||MEDIUM
EPSS-0.14% / 33.91%
||
7 Day CHG~0.00%
Published-27 Sep, 2024 | 16:39
Updated-15 Apr, 2026 | 00:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

Applications that parse ETags from "If-Match" or "If-None-Match" request headers are vulnerable to DoS attack. Users of affected versions should upgrade to the corresponding fixed version. Users of older, unsupported versions could enforce a size limit on "If-Match" and "If-None-Match" headers, e.g. through a Filter.

Action-Not Available
Vendor-N/AVMware (Broadcom Inc.)
Product-Spring Frameworkspring_framework
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2024-38520
Matching Score-4
Assigner-GitHub, Inc.
ShareView Details
Matching Score-4
Assigner-GitHub, Inc.
CVSS Score-5.3||MEDIUM
EPSS-0.10% / 26.68%
||
7 Day CHG~0.00%
Published-26 Jun, 2024 | 18:59
Updated-15 Apr, 2026 | 00:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
SoftEther VPN with L2TP - 2.75x Amplification

SoftEtherVPN is a an open-source cross-platform multi-protocol VPN Program. When SoftEtherVPN is deployed with L2TP enabled on a device, it introduces the possibility of the host being used for amplification/reflection traffic generation because it will respond to every packet with two response packets that are larger than the request packet size. These sorts of techniques are used by external actors who generate spoofed source IPs to target a destination on the internet. This vulnerability has been patched in version 5.02.5185.

Action-Not Available
Vendor-SoftEtherVPNsoftether
Product-SoftEtherVPNvpn
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2021-36187
Matching Score-4
Assigner-Fortinet, Inc.
ShareView Details
Matching Score-4
Assigner-Fortinet, Inc.
CVSS Score-5.3||MEDIUM
EPSS-1.12% / 78.61%
||
7 Day CHG~0.00%
Published-02 Nov, 2021 | 18:32
Updated-25 Oct, 2024 | 13:45
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

A uncontrolled resource consumption in Fortinet FortiWeb version 6.4.0, version 6.3.15 and below, 6.2.5 and below allows attacker to cause a denial of service for webserver daemon via crafted HTTP requests

Action-Not Available
Vendor-Fortinet, Inc.
Product-fortiwebFortinet FortiWeb
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2021-39171
Matching Score-4
Assigner-GitHub, Inc.
ShareView Details
Matching Score-4
Assigner-GitHub, Inc.
CVSS Score-5.3||MEDIUM
EPSS-0.47% / 64.90%
||
7 Day CHG~0.00%
Published-27 Aug, 2021 | 22:05
Updated-04 Aug, 2024 | 01:58
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Unlimited transforms allowed for signed nodes

Passport-SAML is a SAML 2.0 authentication provider for Passport, the Node.js authentication library. Prior to version 3.1.0, a malicious SAML payload can require transforms that consume significant system resources to process, thereby resulting in reduced or denied service. This would be an effective way to perform a denial-of-service attack. This has been resolved in version 3.1.0. The resolution is to limit the number of allowable transforms to 2.

Action-Not Available
Vendor-passport-saml_projectnode-saml
Product-passport-samlpassport-saml
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2025-54575
Matching Score-4
Assigner-GitHub, Inc.
ShareView Details
Matching Score-4
Assigner-GitHub, Inc.
CVSS Score-5.3||MEDIUM
EPSS-0.34% / 56.69%
||
7 Day CHG~0.00%
Published-30 Jul, 2025 | 19:55
Updated-31 Jul, 2025 | 18:42
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
ImageSharp Triggers an Infinite Loop in its GIF Decoder When Skipping Malformed Comment Extension Blocks

ImageSharp is a 2D graphics library. In versions below 2.1.11 and 3.0.0 through 3.1.10, a specially crafted GIF file containing a malformed comment extension block (with a missing block terminator) can cause the ImageSharp GIF decoder to enter an infinite loop while attempting to skip the block. This leads to a denial of service. Applications processing untrusted GIF input should upgrade to a patched version. This issue is fixed in versions 2.1.11 and 3.1.11.

Action-Not Available
Vendor-SixLabors
Product-ImageSharp
CWE ID-CWE-400
Uncontrolled Resource Consumption
CWE ID-CWE-770
Allocation of Resources Without Limits or Throttling
CVE-2024-33498
Matching Score-4
Assigner-Siemens
ShareView Details
Matching Score-4
Assigner-Siemens
CVSS Score-6.9||MEDIUM
EPSS-0.53% / 67.55%
||
7 Day CHG~0.00%
Published-14 May, 2024 | 10:03
Updated-15 Apr, 2026 | 00:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

A vulnerability has been identified in SIMATIC RTLS Locating Manager (6GT2780-0DA00) (All versions < V3.0.1.1), SIMATIC RTLS Locating Manager (6GT2780-0DA10) (All versions < V3.0.1.1), SIMATIC RTLS Locating Manager (6GT2780-0DA20) (All versions < V3.0.1.1), SIMATIC RTLS Locating Manager (6GT2780-0DA30) (All versions < V3.0.1.1), SIMATIC RTLS Locating Manager (6GT2780-1EA10) (All versions < V3.0.1.1), SIMATIC RTLS Locating Manager (6GT2780-1EA20) (All versions < V3.0.1.1), SIMATIC RTLS Locating Manager (6GT2780-1EA30) (All versions < V3.0.1.1). Affected applications do not properly release memory that is allocated when handling specifically crafted incoming packets. This could allow an unauthenticated remote attacker to cause a denial of service condition by crashing the service when it runs out of memory. The service is restarted automatically after a short time.

Action-Not Available
Vendor-Siemens AG
Product-SIMATIC RTLS Locating Managersimatic_rtls_locating_manager
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2024-31152
Matching Score-4
Assigner-Talos
ShareView Details
Matching Score-4
Assigner-Talos
CVSS Score-5.3||MEDIUM
EPSS-9.65% / 93.07%
||
7 Day CHG~0.00%
Published-30 Oct, 2024 | 13:35
Updated-13 Nov, 2024 | 18:15
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

The LevelOne WBR-6012 router with firmware R0.40e6 is vulnerable to improper resource allocation within its web application, where a series of crafted HTTP requests can cause a reboot. This could lead to network service interruptions.

Action-Not Available
Vendor-level1LevelOnelevelone
Product-wbr-6012_firmwarewbr-6012WBR-6012wbr-6012
CWE ID-CWE-400
Uncontrolled Resource Consumption
CWE ID-CWE-770
Allocation of Resources Without Limits or Throttling
CVE-2020-12739
Matching Score-4
Assigner-MITRE Corporation
ShareView Details
Matching Score-4
Assigner-MITRE Corporation
CVSS Score-5.3||MEDIUM
EPSS-0.80% / 74.52%
||
7 Day CHG~0.00%
Published-03 Aug, 2020 | 16:35
Updated-04 Aug, 2024 | 12:04
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

A denial-of-service vulnerability in the Fanuc i Series CNC (0i-MD and 0i Mate-MD) could allow an unauthenticated, remote attacker to cause an affected CNC to become inaccessible to other devices.

Action-Not Available
Vendor-fanucn/a
Product-series_31iseries_30iseries_35i-bseries_0i-model_b_firmwareseries_35i-b_firmwarepower_motion_i-model_aseries_16iseries_18iseries_18i_firmwareseries_0i-model_f_plus_firmwareseries_0i-model_dseries_0i-model_fseries_16i_firmwareseries_0i-mate_d_firmwareseries_0i-model_cseries_31i_firmwareseries_0i-model_f_plusseries_0i-mate_dseries_0i-model_d_firmwareseries_32i-b_plusseries_0i-model_f_firmwareseries_0i-model_bpower_motion_i-model_a_firmwareseries_32i-model_aseries_21i-model_b_firmwareseries_21i-model_bseries_18i-wbseries_0i-model_c_firmwareseries_18i-wb_firmwareseries_32i-b_plus_firmwareseries_32i-model_a_firmwareseries_30i_firmwaren/a
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2024-23323
Matching Score-4
Assigner-GitHub, Inc.
ShareView Details
Matching Score-4
Assigner-GitHub, Inc.
CVSS Score-4.3||MEDIUM
EPSS-0.02% / 6.10%
||
7 Day CHG~0.00%
Published-09 Feb, 2024 | 22:50
Updated-01 Aug, 2024 | 22:59
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Excessive CPU usage when URI template matcher is configured using regex in Envoy

Envoy is a high-performance edge/middle/service proxy. The regex expression is compiled for every request and can result in high CPU usage and increased request latency when multiple routes are configured with such matchers. This issue has been addressed in released 1.29.1, 1.28.1, 1.27.3, and 1.26.7. Users are advised to upgrade. There are no known workarounds for this vulnerability.

Action-Not Available
Vendor-envoyproxyenvoyproxy
Product-envoyenvoy
CWE ID-CWE-400
Uncontrolled Resource Consumption
CWE ID-CWE-1176
Inefficient CPU Computation
CVE-2026-46843
Matching Score-4
Assigner-Oracle
ShareView Details
Matching Score-4
Assigner-Oracle
CVSS Score-5.3||MEDIUM
EPSS-0.05% / 14.95%
||
7 Day CHG~0.00%
Published-28 May, 2026 | 20:17
Updated-03 Jun, 2026 | 16:52
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

Vulnerability in Oracle REST Data Services (component: Core). Supported versions that are affected are 24.2.0-26.1.0. Easily exploitable vulnerability allows unauthenticated attacker with network access via HTTPS to compromise Oracle REST Data Services. Successful attacks of this vulnerability can result in unauthorized ability to cause a partial denial of service (partial DOS) of Oracle REST Data Services. CVSS 3.1 Base Score 5.3 (Availability impacts). CVSS Vector: (CVSS:3.1/AV:N/AC:L/PR:N/UI:N/S:U/C:N/I:N/A:L).

Action-Not Available
Vendor-Oracle Corporation
Product-rest_data_servicesOracle REST Data Services
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2026-8319
Matching Score-4
Assigner-VulDB
ShareView Details
Matching Score-4
Assigner-VulDB
CVSS Score-6.9||MEDIUM
EPSS-0.06% / 17.53%
||
7 Day CHG~0.00%
Published-11 May, 2026 | 18:45
Updated-12 May, 2026 | 16:23
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
aiwaves-cn agents cheshire_cat_core stray_cat.py recall_relevant_memories_to_working_memory resource consumption

A weakness has been identified in aiwaves-cn agents up to e8c4e3c2d19739d3dff59e577d1c97090cc15f59. Affected by this issue is the function recall_relevant_memories_to_working_memory of the file core/cat/looking_glass/stray_cat.py of the component cheshire_cat_core. This manipulation causes resource consumption. Remote exploitation of the attack is possible. The exploit has been made available to the public and could be used for attacks. This product follows a rolling release approach for continuous delivery, so version details for affected or updated releases are not provided. The project was informed of the problem early through an issue report but has not responded yet.

Action-Not Available
Vendor-aiwaves-cn
Product-agents
CWE ID-CWE-400
Uncontrolled Resource Consumption
CWE ID-CWE-404
Improper Resource Shutdown or Release
CVE-2024-21914
Matching Score-4
Assigner-Rockwell Automation
ShareView Details
Matching Score-4
Assigner-Rockwell Automation
CVSS Score-5.3||MEDIUM
EPSS-0.04% / 13.81%
||
7 Day CHG~0.00%
Published-25 Mar, 2024 | 21:27
Updated-19 Sep, 2025 | 15:26
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Rockwell Automation - FactoryTalk® View ME on PanelView™ Plus 7 Boot Terminal lack Security Protections

A vulnerability exists in the affected product that allows a malicious user to restart the Rockwell Automation PanelView™ Plus 7 terminal remotely without security protections. If the vulnerability is exploited, it could lead to the loss of view or control of the PanelView™ product.

Action-Not Available
Vendor-Rockwell Automation, Inc.
Product-factorytalk_viewFactoryTalk® View MEfactorytalk_view_me
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2026-8187
Matching Score-4
Assigner-VulDB
ShareView Details
Matching Score-4
Assigner-VulDB
CVSS Score-6.9||MEDIUM
EPSS-0.03% / 10.78%
||
7 Day CHG~0.00%
Published-09 May, 2026 | 10:58
Updated-13 May, 2026 | 16:08
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Open5GS UPF gtp-path.c _gtpv1_u_recv_cb resource consumption

A flaw has been found in Open5GS up to 2.7.7. This impacts the function _gtpv1_u_recv_cb of the file src/upf/gtp-path.c of the component UPF. Executing a manipulation can lead to resource consumption. The attack may be performed from remote. The project was informed of the problem early through an issue report but has not responded yet.

Action-Not Available
Vendor-open5gsn/a
Product-open5gsOpen5GS
CWE ID-CWE-400
Uncontrolled Resource Consumption
CWE ID-CWE-404
Improper Resource Shutdown or Release
CVE-2026-7493
Matching Score-4
Assigner-Wordfence
ShareView Details
Matching Score-4
Assigner-Wordfence
CVSS Score-5.3||MEDIUM
EPSS-0.06% / 20.07%
||
7 Day CHG~0.00%
Published-27 May, 2026 | 01:26
Updated-27 May, 2026 | 10:42
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Appointment Booking Calendar — Simply Schedule Appointments Booking Plugin <= 1.6.11.5 - Unauthenticated Denial of Service

The Appointment Booking Calendar — Simply Schedule Appointments Booking Plugin plugin for WordPress is vulnerable to denial of service in all versions up to, and including, 1.6.11.5. This is due to a publicly accessible REST API endpoint (/wp-json/ssa/v1/async) that calls PHP's sleep() function on a user-supplied delay parameter without any rate limiting. This makes it possible for unauthenticated attackers to exhaust PHP worker processes, denying access to the site to legitimate users.

Action-Not Available
Vendor-N Squared Digital, LLC
Product-Appointment Booking Calendar — Simply Schedule Appointments Booking Plugin
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2026-6777
Matching Score-4
Assigner-Mozilla Corporation
ShareView Details
Matching Score-4
Assigner-Mozilla Corporation
CVSS Score-5.3||MEDIUM
EPSS-0.06% / 19.28%
||
7 Day CHG~0.00%
Published-21 Apr, 2026 | 12:41
Updated-27 May, 2026 | 17:02
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Other issue in the Networking: DNS component

Other issue in the Networking: DNS component. This vulnerability was fixed in Firefox 150 and Thunderbird 150.

Action-Not Available
Vendor-Mozilla Corporation
Product-thunderbirdfirefoxFirefoxThunderbird
CWE ID-CWE-20
Improper Input Validation
CWE ID-CWE-352
Cross-Site Request Forgery (CSRF)
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2021-22100
Matching Score-4
Assigner-VMware by Broadcom
ShareView Details
Matching Score-4
Assigner-VMware by Broadcom
CVSS Score-5.3||MEDIUM
EPSS-0.38% / 59.72%
||
7 Day CHG~0.00%
Published-25 Mar, 2022 | 18:02
Updated-03 Aug, 2024 | 18:30
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

In cloud foundry CAPI versions prior to 1.122, a denial-of-service attack in which a developer can push a service broker that (accidentally or maliciously) causes CC instances to timeout and fail is possible. An attacker can leverage this vulnerability to cause an inability for anyone to push or manage apps.

Action-Not Available
Vendor-n/aCloud Foundry
Product-capi-releasecf-deploymentCloud Controller (CAPI) by cloud foundry
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2016-0747
Matching Score-4
Assigner-Red Hat, Inc.
ShareView Details
Matching Score-4
Assigner-Red Hat, Inc.
CVSS Score-5.3||MEDIUM
EPSS-20.02% / 95.62%
||
7 Day CHG~0.00%
Published-15 Feb, 2016 | 19:00
Updated-06 May, 2026 | 22:30
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

The resolver in nginx before 1.8.1 and 1.9.x before 1.9.10 does not properly limit CNAME resolution, which allows remote attackers to cause a denial of service (worker process resource consumption) via vectors related to arbitrary name resolution.

Action-Not Available
Vendor-n/aCanonical Ltd.Apple Inc.openSUSEF5, Inc.Debian GNU/Linux
Product-debian_linuxubuntu_linuxxcodeleapnginxn/a
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2026-5986
Matching Score-4
Assigner-VulDB
ShareView Details
Matching Score-4
Assigner-VulDB
CVSS Score-6.9||MEDIUM
EPSS-0.06% / 19.00%
||
7 Day CHG~0.00%
Published-09 Apr, 2026 | 22:30
Updated-24 Apr, 2026 | 18:02
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Zod jsVideoUrlParser util.js getTime redos

A weakness has been identified in Zod jsVideoUrlParser up to 0.5.1. The impacted element is the function getTime in the library lib/util.js. This manipulation of the argument timestamp causes inefficient regular expression complexity. It is possible to initiate the attack remotely. The exploit has been made available to the public and could be used for attacks. The project was informed of the problem early through an issue report but has not responded yet.

Action-Not Available
Vendor-Zod
Product-jsVideoUrlParser
CWE ID-CWE-1333
Inefficient Regular Expression Complexity
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2026-6607
Matching Score-4
Assigner-VulDB
ShareView Details
Matching Score-4
Assigner-VulDB
CVSS Score-6.9||MEDIUM
EPSS-0.02% / 7.26%
||
7 Day CHG~0.00%
Published-20 Apr, 2026 | 05:00
Updated-22 Apr, 2026 | 20:22
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
lm-sys fastchat Worker API Endpoint api_generate resource consumption

A security vulnerability has been detected in lm-sys fastchat up to 0.2.36. This issue affects the function api_generate of the component Worker API Endpoint. The manipulation leads to resource consumption. The attack can be initiated remotely. The exploit has been disclosed publicly and may be used. The identifier of the patch is c9e84b89c91d45191dc24466888de526fa04cf33. It is suggested to install a patch to address this issue. Commit ff66426 patched this issue in api_generate of base_model_worker.py and did miss other entry points.

Action-Not Available
Vendor-lm-sys
Product-fastchat
CWE ID-CWE-400
Uncontrolled Resource Consumption
CWE ID-CWE-404
Improper Resource Shutdown or Release
CVE-2026-48525
Matching Score-4
Assigner-GitHub, Inc.
ShareView Details
Matching Score-4
Assigner-GitHub, Inc.
CVSS Score-5.3||MEDIUM
EPSS-0.05% / 17.18%
||
7 Day CHG~0.00%
Published-28 May, 2026 | 15:11
Updated-28 May, 2026 | 18:03
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
PyJWT: Unauthenticated DoS via unbounded Base64URL decoding of unused payload segment in b64=false detached JWS

PyJWT is a JSON Web Token implementation in Python. From 2.8.0 to 2.12.1, when verifying detached JWS tokens using the unencoded-payload option ("b64": false, RFC 7797), PyJWT performs Base64URL decoding of the compact-serialization payload segment before enforcing the detached-payload rules. For b64=false, PyJWT later discards that decoded payload and replaces it with the caller-provided detached_payload. In practice, this turns the middle segment into an attacker-controlled “work amplifier”: a remote client can supply an arbitrarily large Base64URL payload segment that forces CPU work + memory allocations even if the signature is invalid. This creates an unauthenticated DoS vector against any endpoint that verifies detached JWS using PyJWT. This vulnerability is fixed in 2.13.0.

Action-Not Available
Vendor-jpadilla
Product-pyjwt
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2026-47706
Matching Score-4
Assigner-GitHub, Inc.
ShareView Details
Matching Score-4
Assigner-GitHub, Inc.
CVSS Score-5.3||MEDIUM
EPSS-0.05% / 16.31%
||
7 Day CHG~0.00%
Published-04 Jun, 2026 | 14:06
Updated-05 Jun, 2026 | 17:37
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Strawberry GraphQL has a Circular Fragment Reference DOS

Strawberry GraphQL is a library for creating GraphQL APIs. In versions 0.71.0 through 0.315.6, the QueryDepthLimiter extension is vulnerable to an Application-level DOS due to a lack of cycle detection in fragment spreads. When a query contains circular fragment references the determine_depth function enters an infinite recursion, leading to a RecursionError and crashing the validation process. Version 0.315.7 patches the issue.

Action-Not Available
Vendor-strawberrystrawberry-graphql
Product-strawberry_graphqlstrawberry
CWE ID-CWE-400
Uncontrolled Resource Consumption
CWE ID-CWE-674
Uncontrolled Recursion
CVE-2026-47707
Matching Score-4
Assigner-GitHub, Inc.
ShareView Details
Matching Score-4
Assigner-GitHub, Inc.
CVSS Score-5.3||MEDIUM
EPSS-0.08% / 24.02%
||
7 Day CHG~0.00%
Published-04 Jun, 2026 | 14:12
Updated-05 Jun, 2026 | 17:38
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Strawberry GraphQL's Bypass of MaxAliasesLimiter via Fragment Spreads leading to GraphQL Alias Amplification

Strawberry GraphQL is a library for creating GraphQL APIs. In versions 0.172.0 through0.315.6, the MaxAliasesLimiter extension in Strawberry fails to account for the multiplicative/amplification effect of FragmentSpreadNode. While it correctly counts static aliases within the AST it does not consider how many times a fragments internal aliases are expanded during execution. this allows an attacker to bypass alias limits and force the server to resolve and render a significantly higher number of aliases than allowed, potentially leading to a dos via resource exhaustion. Version 0.315.7 contains a fix for the issue.

Action-Not Available
Vendor-strawberrystrawberry-graphql
Product-strawberry_graphqlstrawberry
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2026-45031
Matching Score-4
Assigner-GitHub, Inc.
ShareView Details
Matching Score-4
Assigner-GitHub, Inc.
CVSS Score-5.3||MEDIUM
EPSS-0.04% / 12.00%
||
7 Day CHG~0.00%
Published-10 Jun, 2026 | 21:25
Updated-11 Jun, 2026 | 18:41
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
ImageMagick: Policy Bypass in PSD decoder

ImageMagick is free and open-source software used for editing and manipulating digital images. Prior to versions 6.9.13-47 and 7.1.2-22, due to a missing check in the PSD decoder it would be possible to bypass the list-length resource policy when decoding a PSD image. Other security limits would still apply. This issue has been patched in versions 6.9.13-47 and 7.1.2-22.

Action-Not Available
Vendor-ImageMagick Studio LLC
Product-imagemagickImageMagick
CWE ID-CWE-400
Uncontrolled Resource Consumption
CWE ID-CWE-770
Allocation of Resources Without Limits or Throttling
CVE-2024-1410
Matching Score-4
Assigner-Cloudflare, Inc.
ShareView Details
Matching Score-4
Assigner-Cloudflare, Inc.
CVSS Score-3.7||LOW
EPSS-0.47% / 65.21%
||
7 Day CHG~0.00%
Published-12 Mar, 2024 | 18:06
Updated-06 Aug, 2025 | 14:28
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Unbounded storage of information related to connection ID retirement, in quiche

Cloudflare quiche was discovered to be vulnerable to unbounded storage of information related to connection ID retirement, which could lead to excessive resource consumption. Each QUIC connection possesses a set of connection Identifiers (IDs); see RFC 9000 Section 5.1 https://datatracker.ietf.org/doc/html/rfc9000#section-5.1 . Endpoints declare the number of active connection IDs they are willing to support using the active_connection_id_limit transport parameter. The peer can create new IDs using a NEW_CONNECTION_ID frame but must stay within the active ID limit. This is done by retirement of old IDs, the endpoint sends NEW_CONNECTION_ID includes a value in the retire_prior_to field, which elicits a RETIRE_CONNECTION_ID frame as confirmation. An unauthenticated remote attacker can exploit the vulnerability by sending NEW_CONNECTION_ID frames and manipulating the connection (e.g. by restricting the peer's congestion window size) so that RETIRE_CONNECTION_ID frames can only be sent at a slower rate than they are received, leading to storage of information related to connection IDs in an unbounded queue. Quiche versions 0.19.2 and 0.20.1 are the earliest to address this problem. There is no workaround for affected versions.

Action-Not Available
Vendor-Cloudflare, Inc.
Product-quichequiche
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2026-45664
Matching Score-4
Assigner-GitHub, Inc.
ShareView Details
Matching Score-4
Assigner-GitHub, Inc.
CVSS Score-5.3||MEDIUM
EPSS-0.04% / 12.00%
||
7 Day CHG~0.00%
Published-10 Jun, 2026 | 21:30
Updated-11 Jun, 2026 | 18:41
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
ImageMagick: Policy Bypass in MNG coder could

ImageMagick is free and open-source software used for editing and manipulating digital images. Prior to versions 6.9.13-47 and 7.1.2-22, because of a missing check in the MNG coder it would be possible to read more images than the list limit policy would allow resulting in excessive resource use. This issue has been patched in versions 6.9.13-47 and 7.1.2-22.

Action-Not Available
Vendor-ImageMagick Studio LLC
Product-imagemagickImageMagick
CWE ID-CWE-400
Uncontrolled Resource Consumption
CWE ID-CWE-407
Inefficient Algorithmic Complexity
CWE ID-CWE-674
Uncontrolled Recursion
CVE-2026-40347
Matching Score-4
Assigner-GitHub, Inc.
ShareView Details
Matching Score-4
Assigner-GitHub, Inc.
CVSS Score-5.3||MEDIUM
EPSS-0.02% / 6.29%
||
7 Day CHG~0.00%
Published-17 Apr, 2026 | 23:56
Updated-24 Apr, 2026 | 16:51
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Python-Multipart affected by Denial of Service via large multipart preamble or epilogue data

Python-Multipart is a streaming multipart parser for Python. Versions prior to 0.0.26 have a denial of service vulnerability when parsing crafted `multipart/form-data` requests with large preamble or epilogue sections. Upgrade to version 0.0.26 or later, which skips ahead to the next boundary candidate when processing leading CR/LF data and immediately discards epilogue data after the closing boundary.

Action-Not Available
Vendor-fastapiexpertKludex
Product-python-multipartpython-multipart
CWE ID-CWE-400
Uncontrolled Resource Consumption
CWE ID-CWE-834
Excessive Iteration
CVE-2021-32640
Matching Score-4
Assigner-GitHub, Inc.
ShareView Details
Matching Score-4
Assigner-GitHub, Inc.
CVSS Score-5.3||MEDIUM
EPSS-1.15% / 78.94%
||
7 Day CHG~0.00%
Published-25 May, 2021 | 18:25
Updated-03 Aug, 2024 | 23:25
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
ReDoS in Sec-Websocket-Protocol header

ws is an open source WebSocket client and server library for Node.js. A specially crafted value of the `Sec-Websocket-Protocol` header can be used to significantly slow down a ws server. The vulnerability has been fixed in ws@7.4.6 (https://github.com/websockets/ws/commit/00c425ec77993773d823f018f64a5c44e17023ff). In vulnerable versions of ws, the issue can be mitigated by reducing the maximum allowed length of the request headers using the [`--max-http-header-size=size`](https://nodejs.org/api/cli.html#cli_max_http_header_size_size) and/or the [`maxHeaderSize`](https://nodejs.org/api/http.html#http_http_createserver_options_requestlistener) options.

Action-Not Available
Vendor-ws_projectwebsocketsNetApp, Inc.
Product-e-series_performance_analyzerwsws
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2026-28351
Matching Score-4
Assigner-GitHub, Inc.
ShareView Details
Matching Score-4
Assigner-GitHub, Inc.
CVSS Score-6.9||MEDIUM
EPSS-0.02% / 5.40%
||
7 Day CHG~0.00%
Published-27 Feb, 2026 | 20:59
Updated-03 Mar, 2026 | 20:28
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Manipulated RunLengthDecode streams can exhaust RAM

pypdf is a free and open-source pure-python PDF library. Prior to version 6.7.4, an attacker who uses this vulnerability can craft a PDF which leads to large memory usage. This requires parsing the content stream using the RunLengthDecode filter. This has been fixed in pypdf 6.7.4. As a workaround, consider applying the changes from PR #3664.

Action-Not Available
Vendor-pypdf_projectpy-pdf
Product-pypdfpypdf
CWE ID-CWE-400
Uncontrolled Resource Consumption
  • Previous
  • 1
  • 2
  • 3
  • 4
  • 5
  • Next
Details not found