Logo
-

Byte Open Security

(ByteOS Network)

Log In

Sign Up

ByteOS

Security
Vulnerability Details
Registries
Custom Views
Weaknesses
Attack Patterns
Filters & Tools
Vulnerability Details :

CVE-2026-44890

Summary
Assigner-GitHub_M
Assigner Org ID-a0819718-46f1-4df5-94e2-005712e83aaa
Published At-11 Jun, 2026 | 20:52
Updated At-12 Jun, 2026 | 10:05
Rejected At-
Credits

Netty has Unbounded Direct Memory Consumption in its RedisDecoder

Netty is a network application framework for development of protocol servers and clients. In netty-codec-redis prior to versions 4.1.135.Final and 4.2.15.Final, an attacker can cause DoS by sending crafted Redis payloads across multiple connections without `\r\n`. This exhausts the server's direct memory pool (OutOfDirectMemoryError), preventing legitimate connections from being processed. Versions 4.1.135.Final and 4.2.15.Final patch the issue.

Vendors
-
Not available
Products
-
Metrics (CVSS)
VersionBase scoreBase severityVector
Weaknesses
Attack Patterns
Solution/Workaround
References
HyperlinkResource Type
EPSS History
Score
Latest Score
-
N/A
No data available for selected date range
Percentile
Latest Percentile
-
N/A
No data available for selected date range
Stakeholder-Specific Vulnerability Categorization (SSVC)
â–¼Common Vulnerabilities and Exposures (CVE)
cve.org
Assigner:GitHub_M
Assigner Org ID:a0819718-46f1-4df5-94e2-005712e83aaa
Published At:11 Jun, 2026 | 20:52
Updated At:12 Jun, 2026 | 10:05
Rejected At:
â–¼CVE Numbering Authority (CNA)
Netty has Unbounded Direct Memory Consumption in its RedisDecoder

Netty is a network application framework for development of protocol servers and clients. In netty-codec-redis prior to versions 4.1.135.Final and 4.2.15.Final, an attacker can cause DoS by sending crafted Redis payloads across multiple connections without `\r\n`. This exhausts the server's direct memory pool (OutOfDirectMemoryError), preventing legitimate connections from being processed. Versions 4.1.135.Final and 4.2.15.Final patch the issue.

Affected Products
Vendor
The Netty Projectnetty
Product
netty
Versions
Affected
  • >= 4.2.0.Final, < 4.2.15.Final
  • < 4.1.135.Final
Problem Types
TypeCWE IDDescription
CWECWE-400CWE-400: Uncontrolled Resource Consumption
Type: CWE
CWE ID: CWE-400
Description: CWE-400: Uncontrolled Resource Consumption
Metrics
VersionBase scoreBase severityVector
3.17.5HIGH
CVSS:3.1/AV:N/AC:L/PR:N/UI:N/S:U/C:N/I:N/A:H
Version: 3.1
Base score: 7.5
Base severity: HIGH
Vector:
CVSS:3.1/AV:N/AC:L/PR:N/UI:N/S:U/C:N/I:N/A:H
Metrics Other Info
Impacts
CAPEC IDDescription
Solutions

Configurations

Workarounds

Exploits

Credits

Timeline
EventDate
Replaced By

Rejected Reason

References
HyperlinkResource
https://github.com/netty/netty/security/advisories/GHSA-6ghj-frrj-jjj3
x_refsource_CONFIRM
https://github.com/netty/netty/releases/tag/netty-4.1.135.Final
x_refsource_MISC
https://github.com/netty/netty/releases/tag/netty-4.2.15.Final
x_refsource_MISC
Hyperlink: https://github.com/netty/netty/security/advisories/GHSA-6ghj-frrj-jjj3
Resource:
x_refsource_CONFIRM
Hyperlink: https://github.com/netty/netty/releases/tag/netty-4.1.135.Final
Resource:
x_refsource_MISC
Hyperlink: https://github.com/netty/netty/releases/tag/netty-4.2.15.Final
Resource:
x_refsource_MISC
â–¼Authorized Data Publishers (ADP)
CISA ADP Vulnrichment
Affected Products
Metrics
VersionBase scoreBase severityVector
Metrics Other Info
Impacts
CAPEC IDDescription
Solutions

Configurations

Workarounds

Exploits

Credits

Timeline
EventDate
Replaced By

Rejected Reason

References
HyperlinkResource
Information is not available yet
â–¼National Vulnerability Database (NVD)
nvd.nist.gov
Source:security-advisories@github.com
Published At:11 Jun, 2026 | 22:16
Updated At:11 Jun, 2026 | 22:16

Netty is a network application framework for development of protocol servers and clients. In netty-codec-redis prior to versions 4.1.135.Final and 4.2.15.Final, an attacker can cause DoS by sending crafted Redis payloads across multiple connections without `\r\n`. This exhausts the server's direct memory pool (OutOfDirectMemoryError), preventing legitimate connections from being processed. Versions 4.1.135.Final and 4.2.15.Final patch the issue.

CISA Catalog
Date AddedDue DateVulnerability NameRequired Action
N/A
Date Added: N/A
Due Date: N/A
Vulnerability Name: N/A
Required Action: N/A
Metrics
TypeVersionBase scoreBase severityVector
Secondary3.17.5HIGH
CVSS:3.1/AV:N/AC:L/PR:N/UI:N/S:U/C:N/I:N/A:H
Type: Secondary
Version: 3.1
Base score: 7.5
Base severity: HIGH
Vector:
CVSS:3.1/AV:N/AC:L/PR:N/UI:N/S:U/C:N/I:N/A:H
CPE Matches

Weaknesses
CWE IDTypeSource
CWE-400Primarysecurity-advisories@github.com
CWE ID: CWE-400
Type: Primary
Source: security-advisories@github.com
Evaluator Description

Evaluator Impact

Evaluator Solution

Vendor Statements

References
HyperlinkSourceResource
https://github.com/netty/netty/releases/tag/netty-4.1.135.Finalsecurity-advisories@github.com
N/A
https://github.com/netty/netty/releases/tag/netty-4.2.15.Finalsecurity-advisories@github.com
N/A
https://github.com/netty/netty/security/advisories/GHSA-6ghj-frrj-jjj3security-advisories@github.com
N/A
Hyperlink: https://github.com/netty/netty/releases/tag/netty-4.1.135.Final
Source: security-advisories@github.com
Resource: N/A
Hyperlink: https://github.com/netty/netty/releases/tag/netty-4.2.15.Final
Source: security-advisories@github.com
Resource: N/A
Hyperlink: https://github.com/netty/netty/security/advisories/GHSA-6ghj-frrj-jjj3
Source: security-advisories@github.com
Resource: N/A

Change History

0
Information is not available yet

Similar CVEs

1308Records found

CVE-2026-44892
Matching Score-10
Assigner-GitHub, Inc.
ShareView Details
Matching Score-10
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-Not Assigned
Published-12 Jun, 2026 | 05:04
Updated-12 Jun, 2026 | 09:59
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty has a Vulnerable Default Configuration Which Leads to Denial of Service via Unbounded HTTP/3 Header Size

Netty is a network application framework for development of protocol servers and clients. Prior to version 4.2.15.Final, the default configuration of the `Http3ConnectionHandler` in the Netty HTTP/3 codec lacks an enforced maximum header size limit. When a peer does not explicitly specify `HTTP3_SETTINGS_MAX_FIELD_SECTION_SIZE`, the implementation defaults to an unbounded limit. This insecure default configuration allows a malicious client or server to send an enormous number of headers, leading to a memory exhaustion Denial of Service via an `OutOfMemoryError`. Version 4.2.15.Final contains a patch.

Action-Not Available
Vendor-The Netty Project
Product-netty
CWE ID-CWE-1188
Initialization of a Resource with an Insecure Default
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2026-50011
Matching Score-10
Assigner-GitHub, Inc.
ShareView Details
Matching Score-10
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-Not Assigned
Published-12 Jun, 2026 | 14:52
Updated-12 Jun, 2026 | 16:18
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty has unbounded pre-allocation in RedisArrayAggregator from RESP array length

Netty is a network application framework for development of protocol servers and clients. Prior to versions 4.1.135.Final and 4.2.15.Final, RedisArrayAggregator pre-allocates ArrayList with initial capacity equal to the RESP array element count declared in an array header. That count is taken from the wire before the corresponding child messages exist. A small malicious header can claim a huge initial capacity. Versions 4.1.135.Final and 4.2.15.Final patch the issue.

Action-Not Available
Vendor-The Netty Project
Product-netty
CWE ID-CWE-400
Uncontrolled Resource Consumption
CWE ID-CWE-770
Allocation of Resources Without Limits or Throttling
CVE-2026-44250
Matching Score-10
Assigner-GitHub, Inc.
ShareView Details
Matching Score-10
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-Not Assigned
Published-11 Jun, 2026 | 20:49
Updated-12 Jun, 2026 | 13:44
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty: Memory Exhaustion in RedisArrayAggregator due to Deeply Nested Arrays

Netty is a network application framework for development of protocol servers and clients. In netty-codec-redis prior to versions 4.1.135.Final and 4.2.15.Final, an attacker can cause DoS by sending a crafted Redis payload with deeply nested arrays. This forces the server to allocate a massive number of state objects and collections, leading to memory exhaustion and an OutOfMemoryError. Versions 4.1.135.Final and 4.2.15.Final patch the issue.

Action-Not Available
Vendor-The Netty Project
Product-netty
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2026-44248
Matching Score-10
Assigner-GitHub, Inc.
ShareView Details
Matching Score-10
Assigner-GitHub, Inc.
CVSS Score-5.3||MEDIUM
EPSS-0.02% / 4.85%
||
7 Day CHG~0.00%
Published-13 May, 2026 | 18:23
Updated-18 May, 2026 | 12:15
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty: Resource exhaustion in MqttDecoder

Netty is an asynchronous, event-driven network application framework. Prior to 4.2.13.Final and 4.1.133.Final, the MQTT 5 header Properties section is parsed and buffered before any message size limit is applied. Specifically, in MqttDecoder, the decodeVariableHeader() method is called before the bytesRemainingBeforeVariableHeader > maxBytesInMessage check. The decodeVariableHeader() can call other methods which will call decodeProperties(). Effectively, Netty does not apply any limits to the size of the properties being decoded. Additionally, because MqttDecoder extends ReplayingDecoder, Netty will repeatedly re-parse the enormous Properties sections and buffer the bytes in memory, until the entire thing parses to completion. This can cause high resource usage in both CPU and memory. This vulnerability is fixed in 4.2.13.Final and 4.1.133.Final.

Action-Not Available
Vendor-io.nettyThe Netty Project
Product-nettynetty-codec-mqttnetty
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2026-42583
Matching Score-10
Assigner-GitHub, Inc.
ShareView Details
Matching Score-10
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-0.02% / 4.32%
||
7 Day CHG~0.00%
Published-13 May, 2026 | 18:09
Updated-18 May, 2026 | 12:22
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty: Lz4FrameDecoder resource exhaustion

Netty is an asynchronous, event-driven network application framework. Prior to 4.2.13.Final and 4.1.133.Final, Lz4FrameDecoder allocates a ByteBuf of size decompressedLength (up to 32 MB per block) before LZ4 runs. A peer only needs a 21-byte header plus compressedLength payload bytes - 22 bytes if compressedLength == 1 - to force that allocation. This vulnerability is fixed in 4.2.13.Final and 4.1.133.Final.

Action-Not Available
Vendor-io.nettyThe Netty Project
Product-nettynetty-codec-compressionnettynetty-codec
CWE ID-CWE-400
Uncontrolled Resource Consumption
CWE ID-CWE-770
Allocation of Resources Without Limits or Throttling
CVE-2026-42587
Matching Score-10
Assigner-GitHub, Inc.
ShareView Details
Matching Score-10
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-0.02% / 4.78%
||
7 Day CHG~0.00%
Published-13 May, 2026 | 18:22
Updated-18 May, 2026 | 12:20
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty: HttpContentDecompressor maxAllocation bypass via Content-Encoding: br/zstd/snappy enables decompression bomb DoS

Netty is an asynchronous, event-driven network application framework. Prior to 4.2.13.Final and 4.1.133.Final, HttpContentDecompressor accepts a maxAllocation parameter to limit decompression buffer size and prevent decompression bomb attacks. This limit is correctly enforced for gzip and deflate encodings via ZlibDecoder, but is silently ignored when the content encoding is br (Brotli), zstd, or snappy. An attacker can bypass the configured decompression limit by sending a compressed payload with Content-Encoding: br instead of Content-Encoding: gzip, causing unbounded memory allocation and out-of-memory denial of service. The same vulnerability exists in DelegatingDecompressorFrameListener for HTTP/2 connections. This vulnerability is fixed in 4.2.13.Final and 4.1.133.Final.

Action-Not Available
Vendor-io.nettyThe Netty Project
Product-nettynetty-codec-httpnettynetty-codec-http2
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2023-44487
Matching Score-10
Assigner-MITRE Corporation
ShareView Details
Matching Score-10
Assigner-MITRE Corporation
CVSS Score-7.5||HIGH
EPSS-94.39% / 99.97%
||
7 Day CHG-0.01%
Published-10 Oct, 2023 | 00:00
Updated-12 May, 2026 | 15:10
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Known KEV||Action Due Date - 2023-10-31||Apply mitigations per vendor instructions, follow applicable BOD 22-01 guidance for cloud services, or discontinue use of the product if mitigations are unavailable.

The HTTP/2 protocol allows a denial of service (server resource consumption) because request cancellation can reset many streams quickly, as exploited in the wild in August through October 2023.

Action-Not Available
Vendor-varnish_cache_projectamazonlinkerdakkatraefikcaddyserverprojectcontourdenagrpcistioenvoyproxykonghqlinecorpkazu-yamamotonghttp2openrestyn/aRed Hat, Inc.NetApp, Inc.Siemens AGGoF5, Inc.The Netty ProjectThe Apache Software FoundationMicrosoft CorporationApple Inc.Eclipse Foundation AISBLCisco Systems, Inc.Fedora ProjectDebian GNU/LinuxThe IETF Administration LLC (IETF LLC)FacebookNode.js (OpenJS Foundation)Jenkins
Product-nexus_9804nexus_9332d-h2rnexus_9372txnexus_9200istionexus_92160yc_switchfedoranexus_92160yc-xsiplus_s7-1500_cpu_1518-4_pn\/dp_mfp_firmwareenterprise_chat_and_email.netvisual_studio_2022windows_10_22h2node_healthcheck_operatornexus_36180yc-ropenshift_sandboxed_containersnexus_9500_4-slotnexus_93128tx_switchnexus_92300ycbig-ip_nextcost_managementjboss_enterprise_application_platformnexus_9200ycnexus_9332pqnexus_9396txproxygenultra_cloud_core_-_session_management_functionintegration_camel_kintegration_camel_for_spring_bootnexus_3064tazure_kubernetes_servicenexus_93180yc-fxcrosswork_zero_touch_provisioningbig-ip_analyticsnexus_3432d-snexus_93180yc-fx3secure_malware_analyticsopensearch_data_preppersecure_web_appliance_firmwareweb_terminalprime_infrastructurenexus_93180lc-ex_switchopenshift_container_platform_assisted_installercertification_for_red_hat_enterprise_linuxprime_cable_provisioningnexus_93108tc-fx-24connected_mobile_experiencesnexus_92300yc_switchprocess_automationexpresswayhttp_serverunified_attendant_console_advancedopenstack_platformnginx_plusnexus_93240yc-fx2nexus_3636c-rcryostatnexus_3100-zsingle_sign-onopenshift_distributed_tracingnexus_9736pqnexus_9272qnexus_3016qnexus_93108tc-ex-24unified_contact_center_domain_managernexus_9396tx_switchopenshift_developer_tools_and_servicesnexus_93128crosswork_situation_managernexus_93180yc-ex-24nexus_9332pq_switchwindows_server_2022nexus_31108pc-vopenshift_api_for_data_protectionopenshift_gitopsnexus_3132c-zsupport_for_spring_bootwindows_server_2016nexus_3016nexus_3132q-vopenshift_service_mesh3scale_api_management_platformnexus_3464cnexus_9500ropenshiftcaddynexus_3100-vnexus_3132qopenshift_secondary_scheduler_operatornexus_3064-32tnexus_31108tc-varmeriagomigration_toolkit_for_containersbuild_of_optaplannernexus_3232nexus_9372pxbig-ip_websafenexus_9500_supervisor_anexus_9348gc-fxpultra_cloud_core_-_serving_gateway_functionnexus_3172tqnexus_9504windows_10_21h2nexus_3064xnexus_3232cnexus_9636pqnexus_3400jettyansible_automation_platformnexus_9500_supervisor_bnexus_9372tx-ewindows_10_1809nexus_3524-xlnexus_3408-snexus_3172tq-32tnexus_93180tc-exnexus_9516nexus_3524-xnexus_3264c-enexus_3172pqnexus_3172pq\/pq-xlnexus_9336pqastra_control_centernexus_9364c-gxnexus_9336c-fx2simatic_s7-1500_cpu_1518-4_pn\/dpnexus_9236cnexus_9536pqnexus_9236c_switchnexus_93180yc-fx-24nexus_31128pqnetwork_observability_operatorbig-ip_application_security_managerprime_access_registrarswiftnio_http\/2linkerdios_xewindows_11_22h2nexus_9500_supervisor_b\+nexus_9364d-gx2adecision_managerbig-ip_policy_enforcement_managerquaynexus_3264qbusiness_process_automationnexus_3100vsecure_dynamic_attributes_connectornexus_9372tx_switchnexus_9500_supervisor_a\+machine_deletion_remediation_operatornode.jssatellitenexus_9348d-gx2abig-ip_domain_name_systemnexus_3064nexus_9372px-e_switchbig-ip_link_controllernexus_93108tc-ex_switchhttpbig-ip_advanced_firewall_managerprime_network_registrarcert-manager_operator_for_red_hat_openshiftnexus_9432pqtraefikbuild_of_quarkusnexus_3524self_node_remediation_operatorcrosswork_data_gatewaycontournode_maintenance_operatorcbl-marinernexus_9716d-gxsinec_insh2onexus_9332d-gx2bnexus_9372px_switchapisixjboss_core_servicesnexus_9500_16-slotsimatic_s7-1500_cpu_1518-4_pn\/dp_mfp_firmwareoncommand_insightnexus_9372px-enexus_9336pq_aci_spinenexus_3548-xnexus_9221cnexus_9272q_switchnexus_93108tc-fxfirepower_threat_defensebig-ip_fraud_protection_servicewindows_server_2019migration_toolkit_for_virtualizationvarnish_cacheunified_contact_center_enterprisenexus_93108tc-fx3hnexus_93240tc-fx2asp.net_coretelepresence_video_communication_servernexus_93216tc-fx2nexus_3100traffic_servernexus_3064-xnexus_9348gc-fx3nexus_9332cbig-ip_application_visibility_and_reportingnexus_3132q-x\/3132q-xltomcatwindows_10_1607simatic_s7-1500_cpu_1518f-4_pn\/dp_mfp_firmwarenexus_3172tq-xlnexus_3548-xlnexus_9336pq_aci_spine_switchsiplus_s7-1500_cpu_1518-4_pn\/dp_mfpnexus_3164qdebian_linuxnexus_9396px_switchnexus_9396pxlogging_subsystem_for_red_hat_openshiftnexus_9364cbig-ip_webacceleratoropenshift_serverlessnetworkingnexus_9500big-ip_ssl_orchestratornexus_93180yc-ex_switchnexus_9508nexus_3132q-xnexus_93120txnexus_3132q-xlnexus_9408ruggedcom_ape1808_firmwarenexus_34180ycnexus_93180yc-fx3snx-osnexus_93180lc-exunified_contact_center_management_portalnexus_92304qc_switchdata_center_network_manageropenrestynexus_92348gc-xbig-ip_application_acceleration_manageropenshift_virtualizationnexus_93108tc-fx3pnexus_93360yc-fx2nexus_3172pq-xlnexus_31108pv-vgrpcnexus_93128txnexus_3064-tadvanced_cluster_management_for_kubernetesbig-ip_advanced_web_application_firewallenvoynexus_3232c_big-ip_global_traffic_managernginxfence_agents_remediation_operatorjboss_data_gridios_xrfog_directorsimatic_s7-1500_cpu_1518f-4_pn\/dp_mfpbig-ip_carrier-grade_natnexus_9300windows_11_21h2secure_web_applianceintegration_service_registryhttp2openshift_dev_spacesbig-ip_ddos_hybrid_defendernexus_93180yc-fx3hservice_interconnectnghttp2openshift_data_sciencest7_scadaconnectnexus_93120tx_switchbig-ip_local_traffic_managerbig-ip_access_policy_managerjboss_fuseopenshift_container_platformopenshift_pipelinesnexus_3048nexus_9508_switchnettynexus_9336c-fx2-enexus_93600cd-gxnexus_34200yc-smnexus_9516_switchceph_storagenexus_3600jboss_a-mqrun_once_duration_override_operatornexus_9000vnexus_3172nexus_3500sinec_nmsruggedcom_ape1808nexus_9336pq_acinexus_9316d-gxnexus_9800kong_gatewayadvanced_cluster_securitynexus_3548-x\/xlunified_contact_center_enterprise_-_live_data_serverultra_cloud_core_-_policy_control_functionbig-ip_next_service_proxy_for_kubernetesnexus_9232enexus_9808jboss_a-mq_streamsnexus_92304qciot_field_network_directornexus_9500_8-slotmigration_toolkit_for_applicationsnexus_3200solrjenkinsnginx_ingress_controllernexus_93180yc-exnexus_9372tx-e_switchnexus_93108tc-exnexus_9504_switchnexus_3524-x\/xlnexus_3548service_telemetry_frameworkenterprise_linuxn/aRUGGEDCOM APE1808SINEC NMSSIPLUS S7-1500 CPU 1518-4 PN/DP MFPSIMATIC S7-1500 CPU 1518F-4 PN/DP MFPSIMATIC S7-1500 CPU 1518-4 PN/DP MFPhttpHTTP/2
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2021-37137
Matching Score-10
Assigner-JFrog
ShareView Details
Matching Score-10
Assigner-JFrog
CVSS Score-7.5||HIGH
EPSS-2.38% / 85.34%
||
7 Day CHG~0.00%
Published-19 Oct, 2021 | 00:00
Updated-04 Aug, 2024 | 01:16
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

The Snappy frame decoder function doesn't restrict the chunk length which may lead to excessive memory usage. Beside this it also may buffer reserved skippable chunks until the whole chunk was received which may lead to excessive memory usage as well. This vulnerability can be triggered by supplying malicious input that decompresses to a very big size (via a network stream or a file) or by sending a huge skippable chunk.

Action-Not Available
Vendor-quarkusThe Netty ProjectNetApp, Inc.Debian GNU/LinuxOracle Corporation
Product-communications_diameter_signaling_routerbanking_apispeoplesoft_enterprise_peopletoolsdebian_linuxbanking_digital_experiencequarkusnettycommunications_cloud_native_core_binding_support_functioncommerce_guided_searchcommunications_brm_-_elastic_charging_enginewebcenter_portaloncommand_insightNetty
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2021-37136
Matching Score-10
Assigner-JFrog
ShareView Details
Matching Score-10
Assigner-JFrog
CVSS Score-7.5||HIGH
EPSS-1.19% / 79.22%
||
7 Day CHG~0.00%
Published-19 Oct, 2021 | 00:00
Updated-04 Aug, 2024 | 01:16
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

The Bzip2 decompression decoder function doesn't allow setting size restrictions on the decompressed output data (which affects the allocation size used during decompression). All users of Bzip2Decoder are affected. The malicious input can trigger an OOME and so a DoS attack

Action-Not Available
Vendor-quarkusThe Netty ProjectNetApp, Inc.Debian GNU/LinuxOracle Corporation
Product-communications_diameter_signaling_routercoherencepeoplesoft_enterprise_peopletoolscommunications_cloud_native_core_network_slice_selection_functionbanking_digital_experiencequarkuscommunications_cloud_native_core_security_edge_protection_proxyhelidoncommunications_instant_messaging_servercommunications_cloud_native_core_policycommunications_brm_-_elastic_charging_enginebanking_apisdebian_linuxcommunications_cloud_native_core_unified_data_repositorynettycommunications_cloud_native_core_binding_support_functioncommerce_guided_searchwebcenter_portaloncommand_insightNetty
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2026-45416
Matching Score-8
Assigner-GitHub, Inc.
ShareView Details
Matching Score-8
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-Not Assigned
Published-12 Jun, 2026 | 14:10
Updated-12 Jun, 2026 | 15:55
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty: SNI handler pre-allocates up to 16 MiB from nine attacker bytes

Netty is a network application framework for development of protocol servers and clients. Prior to versions 4.1.135.Final and 4.2.15.Final, SslClientHelloHandler.decode() reads the 24-bit TLS handshake length and, when the ClientHello does not fit in the first record, eagerly allocates `ctx.alloc().buffer(handshakeLength)` (line 161). The guard at line 140 is `handshakeLength > maxClientHelloLength && maxClientHelloLength != 0`, and the commonly-used SniHandler/AbstractSniHandler constructors (SniHandler(Mapping), SniHandler(AsyncMapping), AbstractSniHandler()) pass maxClientHelloLength=0 and handshakeTimeoutMillis=0, so the length guard is disabled and no timeout is scheduled. A 16 MiB request exceeds the default pooled chunk size and becomes a huge/unpooled allocation performed immediately. The buffer is retained in the handler until the channel closes. Versions 4.1.135.Final and 4.2.15.Final patch the issue.

Action-Not Available
Vendor-The Netty Project
Product-netty
CWE ID-CWE-770
Allocation of Resources Without Limits or Throttling
CVE-2026-48748
Matching Score-8
Assigner-GitHub, Inc.
ShareView Details
Matching Score-8
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-Not Assigned
Published-12 Jun, 2026 | 14:45
Updated-12 Jun, 2026 | 16:18
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty HTTP/3 QPACK Blocked Streams Memory Exhaustion

Netty is a network application framework for development of protocol servers and clients. Prior to version 4.2.15.Final, a memory exhaustion vulnerability in the Netty HTTP/3 codec allows the creation of an infinite number of blocked streams, which can cause OOM error. Version 4.2.15.Final patches the issue.

Action-Not Available
Vendor-The Netty Project
Product-netty
CWE ID-CWE-770
Allocation of Resources Without Limits or Throttling
CVE-2026-46340
Matching Score-8
Assigner-GitHub, Inc.
ShareView Details
Matching Score-8
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-Not Assigned
Published-12 Jun, 2026 | 14:19
Updated-12 Jun, 2026 | 16:31
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty: SCTP reassembly nests buffers without bound

Netty is a network application framework for development of protocol servers and clients. In versions of netty-transport-sctp prior to 4.1.135.Final and 4.2.15.Final, for each non-complete SctpMessage fragment the handler does `fragments.put(streamId, Unpooled.wrappedBuffer(frag, byteBuf))`, wrapping the previous accumulator and the new slice into a *new* CompositeByteBuf every time. After N fragments the accumulator is an N-deep chain of composites, each holding references and component arrays; readableBytes()/getBytes() on the final buffer recurse N levels. There is no limit on N, on total bytes, or on the number of streamIdentifiers an attacker can open (each gets its own map entry). A peer that never sets the `complete` flag can grow this structure indefinitely from tiny 1-byte DATA chunks. Versions 4.1.135.Final and 4.2.15.Final patch the issue.

Action-Not Available
Vendor-The Netty Project
Product-netty
CWE ID-CWE-770
Allocation of Resources Without Limits or Throttling
CVE-2026-44893
Matching Score-8
Assigner-GitHub, Inc.
ShareView Details
Matching Score-8
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-Not Assigned
Published-12 Jun, 2026 | 14:00
Updated-12 Jun, 2026 | 19:02
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty: HAProxy SSL TLV parsing leaks retained slice on invalid TLV length

Netty is a network application framework for development of protocol servers and clients. In netty-codec-haproxy prior to versions 4.1.135.Final and 4.2.15.Final, when decoding a PP2_TYPE_SSL TLV, HAProxyMessage.readNextTLV() first calls `header.retainedSlice(header.readerIndex(), length)` and only then reads the 1-byte client field and 4-byte verify field. If the attacker sets the TLV length below 5, the subsequent readByte/readInt throws IndexOutOfBoundsException. HAProxyMessageDecoder only catches HAProxyProtocolException around this call, so the IOOBE propagates and the retained slice on the pooled cumulation buffer is never released. Versions 4.1.135.Final and 4.2.15.Final patch the issue.

Action-Not Available
Vendor-The Netty Project
Product-netty
CWE ID-CWE-703
Improper Check or Handling of Exceptional Conditions
CVE-2025-55163
Matching Score-8
Assigner-GitHub, Inc.
ShareView Details
Matching Score-8
Assigner-GitHub, Inc.
CVSS Score-8.2||HIGH
EPSS-0.12% / 30.88%
||
7 Day CHG+0.07%
Published-13 Aug, 2025 | 14:17
Updated-04 Nov, 2025 | 22:16
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty MadeYouReset HTTP/2 DDoS Vulnerability

Netty is an asynchronous, event-driven network application framework. Prior to versions 4.1.124.Final and 4.2.4.Final, Netty is vulnerable to MadeYouReset DDoS. This is a logical vulnerability in the HTTP/2 protocol, that uses malformed HTTP/2 control frames in order to break the max concurrent streams limit - which results in resource exhaustion and distributed denial of service. This issue has been patched in versions 4.1.124.Final and 4.2.4.Final.

Action-Not Available
Vendor-The Netty Project
Product-nettynetty
CWE ID-CWE-770
Allocation of Resources Without Limits or Throttling
CVE-2020-11612
Matching Score-8
Assigner-MITRE Corporation
ShareView Details
Matching Score-8
Assigner-MITRE Corporation
CVSS Score-7.5||HIGH
EPSS-4.33% / 89.15%
||
7 Day CHG~0.00%
Published-07 Apr, 2020 | 18:00
Updated-04 Aug, 2024 | 11:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

The ZlibDecoders in Netty 4.1.x before 4.1.46 allow for unbounded memory allocation while decoding a ZlibEncoded byte stream. An attacker could send a large ZlibEncoded byte stream to the Netty server, forcing the server to allocate all of its free memory to a single decoder.

Action-Not Available
Vendor-n/aThe Netty ProjectNetApp, Inc.Debian GNU/LinuxFedora ProjectOracle Corporation
Product-communications_cloud_native_core_service_communication_proxysiebel_core_-_server_frameworkdebian_linuxoncommand_api_servicescommunications_messaging_servernettynosql_databasecommunications_design_studiofedoraoncommand_workflow_automationcommunications_brm_-_elastic_charging_enginewebcenter_portaloncommand_insightn/a
CWE ID-CWE-770
Allocation of Resources Without Limits or Throttling
CVE-2026-42577
Matching Score-8
Assigner-GitHub, Inc.
ShareView Details
Matching Score-8
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-0.05% / 16.46%
||
7 Day CHG~0.00%
Published-13 May, 2026 | 18:00
Updated-18 May, 2026 | 14:05
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty: epoll transport denial of service via RST on half-closed TCP connection

Netty is an asynchronous, event-driven network application framework. From 4.2.0.Final to 4.2.13.Final , Netty's epoll transport fails to detect and close TCP connections that receive a RST after being half-closed, leading to stale channels that are never cleaned up and, in some code paths, a 100% CPU busy-loop in the event loop thread. This vulnerability is fixed in 4.2.13.Final.

Action-Not Available
Vendor-The Netty Project
Product-nettynetty
CWE ID-CWE-772
Missing Release of Resource after Effective Lifetime
CVE-2026-33871
Matching Score-8
Assigner-GitHub, Inc.
ShareView Details
Matching Score-8
Assigner-GitHub, Inc.
CVSS Score-8.7||HIGH
EPSS-0.04% / 11.77%
||
7 Day CHG~0.00%
Published-27 Mar, 2026 | 19:55
Updated-31 Mar, 2026 | 18:54
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty HTTP/2 CONTINUATION Frame Flood DoS via Zero-Byte Frame Bypass

Netty is an asynchronous, event-driven network application framework. In versions prior to 4.1.132.Final and 4.2.10.Final, a remote user can trigger a Denial of Service (DoS) against a Netty HTTP/2 server by sending a flood of `CONTINUATION` frames. The server's lack of a limit on the number of `CONTINUATION` frames, combined with a bypass of existing size-based mitigations using zero-byte frames, allows an user to cause excessive CPU consumption with minimal bandwidth, rendering the server unresponsive. Versions 4.1.132.Final and 4.2.10.Final fix the issue.

Action-Not Available
Vendor-The Netty Project
Product-nettynetty
CWE ID-CWE-770
Allocation of Resources Without Limits or Throttling
CVE-2025-24970
Matching Score-8
Assigner-GitHub, Inc.
ShareView Details
Matching Score-8
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-0.95% / 76.84%
||
7 Day CHG~0.00%
Published-10 Feb, 2025 | 21:57
Updated-16 Apr, 2025 | 16:15
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
SslHandler doesn't correctly validate packets which can lead to native crash when using native SSLEngine

Netty, an asynchronous, event-driven network application framework, has a vulnerability starting in version 4.1.91.Final and prior to version 4.1.118.Final. When a special crafted packet is received via SslHandler it doesn't correctly handle validation of such a packet in all cases which can lead to a native crash. Version 4.1.118.Final contains a patch. As workaround its possible to either disable the usage of the native SSLEngine or change the code manually.

Action-Not Available
Vendor-The Netty Project
Product-netty
CWE ID-CWE-20
Improper Input Validation
CVE-2025-58057
Matching Score-8
Assigner-GitHub, Inc.
ShareView Details
Matching Score-8
Assigner-GitHub, Inc.
CVSS Score-6.9||MEDIUM
EPSS-0.06% / 19.91%
||
7 Day CHG~0.00%
Published-03 Sep, 2025 | 21:46
Updated-08 Sep, 2025 | 16:45
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty's BrotliDecoder is vulnerable to DoS via zip bomb style attack

Netty is an asynchronous event-driven network application framework for rapid development of maintainable high performance protocol servers & clients. In netty-codec-compression versions 4.1.124.Final and below, and netty-codec versions 4.2.4.Final and below, when supplied with specially crafted input, BrotliDecoder and certain other decompression decoders will allocate a large number of reachable byte buffers, which can lead to denial of service. BrotliDecoder.decompress has no limit in how often it calls pull, decompressing data 64K bytes at a time. The buffers are saved in the output list, and remain reachable until OOM is hit. This is fixed in versions 4.1.125.Final of netty-codec and 4.2.5.Final of netty-codec-compression.

Action-Not Available
Vendor-The Netty Project
Product-nettynetty
CWE ID-CWE-409
Improper Handling of Highly Compressed Data (Data Amplification)
CVE-2026-42582
Matching Score-8
Assigner-GitHub, Inc.
ShareView Details
Matching Score-8
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-0.02% / 4.32%
||
7 Day CHG~0.00%
Published-13 May, 2026 | 18:06
Updated-18 May, 2026 | 12:54
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty: HTTP/3 QPACK literal unbounded allocation

Netty is an asynchronous, event-driven network application framework. Prior to 4.2.13.Final, when decoding header blocks, the non-Huffman branch of io.netty.handler.codec.http3.QpackDecoder#decodeHuffmanEncodedLiteral may execute new byte[length] for a string literal before verifying that length bytes are actually present in the compressed field section. The wire encoding allows a very large length to be expressed in few bytes. There is no check that length <= in.readableBytes() before new byte[length]. This vulnerability is fixed in 4.2.13.Final.

Action-Not Available
Vendor-io.nettyThe Netty Project
Product-nettynettynetty-codec-http3
CWE ID-CWE-770
Allocation of Resources Without Limits or Throttling
CWE ID-CWE-789
Memory Allocation with Excessive Size Value
CVE-2022-41881
Matching Score-8
Assigner-GitHub, Inc.
ShareView Details
Matching Score-8
Assigner-GitHub, Inc.
CVSS Score-5.3||MEDIUM
EPSS-0.47% / 65.12%
||
7 Day CHG+0.02%
Published-12 Dec, 2022 | 00:00
Updated-22 Apr, 2025 | 15:57
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

Netty project is an event-driven asynchronous network application framework. In versions prior to 4.1.86.Final, a StackOverflowError can be raised when parsing a malformed crafted message due to an infinite recursion. This issue is patched in version 4.1.86.Final. There is no workaround, except using a custom HaProxyMessageDecoder.

Action-Not Available
Vendor-Debian GNU/LinuxThe Netty Project
Product-nettydebian_linuxnetty
CWE ID-CWE-674
Uncontrolled Recursion
CVE-2016-4970
Matching Score-8
Assigner-Red Hat, Inc.
ShareView Details
Matching Score-8
Assigner-Red Hat, Inc.
CVSS Score-7.5||HIGH
EPSS-8.23% / 92.41%
||
7 Day CHG~0.00%
Published-13 Apr, 2017 | 14:00
Updated-13 May, 2026 | 00:24
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

handler/ssl/OpenSslEngine.java in Netty 4.0.x before 4.0.37.Final and 4.1.x before 4.1.1.Final allows remote attackers to cause a denial of service (infinite loop).

Action-Not Available
Vendor-n/aThe Netty ProjectThe Apache Software FoundationRed Hat, Inc.
Product-jboss_data_gridnettyjboss_middleware_text-only_advisoriescassandran/a
CWE ID-CWE-835
Loop with Unreachable Exit Condition ('Infinite Loop')
CVE-2026-47244
Matching Score-6
Assigner-GitHub, Inc.
ShareView Details
Matching Score-6
Assigner-GitHub, Inc.
CVSS Score-5.3||MEDIUM
EPSS-Not Assigned
Published-12 Jun, 2026 | 14:23
Updated-12 Jun, 2026 | 15:55
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty HTTP/2: Advertised MAX_CONCURRENT_STREAMS are not enforced

Netty is a network application framework for development of protocol servers and clients. Prior to versions 4.1.135.Final and 4.2.15.Final, DefaultHttp2Connection.DefaultEndpoint initialises maxActiveStreams/maxStreams to Integer.MAX_VALUE, and Http2Settings never inserts SETTINGS_MAX_CONCURRENT_STREAMS by default (Http2Settings.java:305-307 only clamps a user-supplied value). Unless the application explicitly calls initialSettings().maxConcurrentStreams(n), a Netty HTTP/2 server advertises no limit and enforces none locally. Each open stream allocates a DefaultStream object, PropertyMap slots, flow-controller state and IntObjectHashMap entry; with ~2^30 permissible odd stream IDs a single TCP connection can create hundreds of thousands of long-lived stream objects. This is also the precondition for CVE-2023-44487-style Rapid-Reset amplification, where the absence of a low concurrent cap multiplies backend work. Versions 4.1.135.Final and 4.2.15.Final patch the issue.

Action-Not Available
Vendor-The Netty Project
Product-netty
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2026-48043
Matching Score-6
Assigner-GitHub, Inc.
ShareView Details
Matching Score-6
Assigner-GitHub, Inc.
CVSS Score-5.3||MEDIUM
EPSS-Not Assigned
Published-12 Jun, 2026 | 14:39
Updated-12 Jun, 2026 | 16:18
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
netty-codec-http2: ByteBuf Reference-Count Leak in DelegatingDecompressorFrameListener Leads to Memory Exhaustion

Netty is a network application framework for development of protocol servers and clients. In netty-codec-http2 prior to versions 4.1.135.Final and 4.2.15.Final, the `DelegatingDecompressorFrameListener` class orchestrates HTTP/2 decompression by embedding a per-stream `EmbeddedChannel` that runs the appropriate decompression codec (gzip, deflate, zstd) and forwards decompressed chunks to a wrapped listener. Each decompressed chunk is a pooled `ByteBuf` handed to an anonymous `ChannelInboundHandlerAdapter` tail handler, which becomes the sole owner responsible for releasing it. A remote peer could send frames that would result in the flow-controller throwing and so trigger a resource leak which at the end might take down the whole JVM due OOME. Versions 4.1.135.Final and 4.2.15.Final patch the issue.

Action-Not Available
Vendor-The Netty Project
Product-netty
CWE ID-CWE-400
Uncontrolled Resource Consumption
CWE ID-CWE-401
Missing Release of Memory after Effective Lifetime
CVE-2026-42579
Matching Score-6
Assigner-GitHub, Inc.
ShareView Details
Matching Score-6
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-0.03% / 9.79%
||
7 Day CHG~0.00%
Published-13 May, 2026 | 18:01
Updated-18 May, 2026 | 17:16
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Netty: DNS Codec Input Validation Bypass in Netty (Encoder + Decoder)

Netty is an asynchronous, event-driven network application framework. Prior to 4.2.13.Final and 4.1.133.Final, Netty's DNS codec does not enforce RFC 1035 domain name constraints during either encoding or decoding. This creates a bidirectional attack surface: malicious DNS responses can exploit the decoder, and user-influenced hostnames can exploit the encoder. This vulnerability is fixed in 4.2.13.Final and 4.1.133.Final.

Action-Not Available
Vendor-The Netty Project
Product-nettynetty
CWE ID-CWE-20
Improper Input Validation
CWE ID-CWE-400
Uncontrolled Resource Consumption
CWE ID-CWE-626
Null Byte Interaction Error (Poison Null Byte)
CVE-2025-25193
Matching Score-6
Assigner-GitHub, Inc.
ShareView Details
Matching Score-6
Assigner-GitHub, Inc.
CVSS Score-5.5||MEDIUM
EPSS-0.10% / 26.48%
||
7 Day CHG~0.00%
Published-10 Feb, 2025 | 22:02
Updated-11 Jun, 2025 | 15:36
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Denial of Service attack on windows app using Netty

Netty, an asynchronous, event-driven network application framework, has a vulnerability in versions up to and including 4.1.118.Final. An unsafe reading of environment file could potentially cause a denial of service in Netty. When loaded on an Windows application, Netty attempts to load a file that does not exist. If an attacker creates such a large file, the Netty application crash. A similar issue was previously reported as CVE-2024-47535. This issue was fixed, but the fix was incomplete in that null-bytes were not counted against the input limit. Commit d1fbda62d3a47835d3fb35db8bd42ecc205a5386 contains an updated fix.

Action-Not Available
Vendor-The Netty ProjectMicrosoft Corporation
Product-nettywindowsnetty
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2023-34462
Matching Score-6
Assigner-GitHub, Inc.
ShareView Details
Matching Score-6
Assigner-GitHub, Inc.
CVSS Score-6.5||MEDIUM
EPSS-0.74% / 73.28%
||
7 Day CHG~0.00%
Published-22 Jun, 2023 | 23:00
Updated-13 Feb, 2025 | 16:55
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
netty-handler SniHandler 16MB allocation

Netty is an asynchronous event-driven network application framework for rapid development of maintainable high performance protocol servers & clients. The `SniHandler` can allocate up to 16MB of heap for each channel during the TLS handshake. When the handler or the channel does not have an idle timeout, it can be used to make a TCP server using the `SniHandler` to allocate 16MB of heap. The `SniHandler` class is a handler that waits for the TLS handshake to configure a `SslHandler` according to the indicated server name by the `ClientHello` record. For this matter it allocates a `ByteBuf` using the value defined in the `ClientHello` record. Normally the value of the packet should be smaller than the handshake packet but there are not checks done here and the way the code is written, it is possible to craft a packet that makes the `SslClientHelloHandler`. This vulnerability has been fixed in version 4.1.94.Final.

Action-Not Available
Vendor-The Netty Project
Product-nettynetty
CWE ID-CWE-400
Uncontrolled Resource Consumption
CWE ID-CWE-770
Allocation of Resources Without Limits or Throttling
CVE-2024-47535
Matching Score-6
Assigner-GitHub, Inc.
ShareView Details
Matching Score-6
Assigner-GitHub, Inc.
CVSS Score-5.5||MEDIUM
EPSS-0.47% / 64.91%
||
7 Day CHG~0.00%
Published-12 Nov, 2024 | 15:50
Updated-05 Sep, 2025 | 14:00
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Denial of Service attack on windows app using Netty

Netty is an asynchronous event-driven network application framework for rapid development of maintainable high performance protocol servers & clients. An unsafe reading of environment file could potentially cause a denial of service in Netty. When loaded on an Windows application, Netty attempts to load a file that does not exist. If an attacker creates such a large file, the Netty application crashes. This vulnerability is fixed in 4.1.115.

Action-Not Available
Vendor-The Netty ProjectMicrosoft Corporation
Product-nettywindowsnettynetty
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2021-41118
Matching Score-4
Assigner-GitHub, Inc.
ShareView Details
Matching Score-4
Assigner-GitHub, Inc.
CVSS Score-5.3||MEDIUM
EPSS-0.37% / 59.01%
||
7 Day CHG~0.00%
Published-04 Oct, 2021 | 18:35
Updated-04 Aug, 2024 | 02:59
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
ReDoS in DynamicPageList3

The DynamicPageList3 extension is a reporting tool for MediaWiki, listing category members and intersections with various formats and details. In affected versions unsanitised input of regular expression date within the parameters of the DPL parser function, allowed for the possibility of ReDoS (Regex Denial of Service). This has been resolved in version 3.3.6. If you are unable to update you may also set `$wgDplSettings['functionalRichness'] = 0;` or disable DynamicPageList3 to mitigate.

Action-Not Available
Vendor-dynamicpagelist3_projectUniversal-Omega
Product-dynamicpagelist3DynamicPageList3
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2013-4120
Matching Score-4
Assigner-Red Hat, Inc.
ShareView Details
Matching Score-4
Assigner-Red Hat, Inc.
CVSS Score-7.5||HIGH
EPSS-0.55% / 68.46%
||
7 Day CHG~0.00%
Published-10 Dec, 2019 | 14:32
Updated-06 Aug, 2024 | 16:30
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

Katello has a Denial of Service vulnerability in API OAuth authentication

Action-Not Available
Vendor-KatelloThe Foreman
Product-katelloKatello
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2025-60638
Matching Score-4
Assigner-MITRE Corporation
ShareView Details
Matching Score-4
Assigner-MITRE Corporation
CVSS Score-7.5||HIGH
EPSS-0.15% / 35.47%
||
7 Day CHG~0.00%
Published-24 Nov, 2025 | 00:00
Updated-01 Dec, 2025 | 16:14
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

An issue was discovered in Free5GC v4.0.0 and v4.0.1 allowing an attacker to cause a denial of service via crafted POST request to the Nnssf_NSSAIAvailability API.

Action-Not Available
Vendor-free5gcn/a
Product-free5gcn/a
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2025-60536
Matching Score-4
Assigner-MITRE Corporation
ShareView Details
Matching Score-4
Assigner-MITRE Corporation
CVSS Score-7.5||HIGH
EPSS-0.03% / 9.25%
||
7 Day CHG~0.00%
Published-14 Oct, 2025 | 00:00
Updated-14 Oct, 2025 | 19:35
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

An issue in the Configure New Cluster interface of kafka-ui v0.6.0 to v0.7.2 allows attackers to cause a Denial of Service (DoS) via uploading a crafted configuration file.

Action-Not Available
Vendor-n/a
Product-n/a
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2026-50645
Matching Score-4
Assigner-Apache Software Foundation
ShareView Details
Matching Score-4
Assigner-Apache Software Foundation
CVSS Score-7.5||HIGH
EPSS-Not Assigned
Published-12 Jun, 2026 | 09:06
Updated-12 Jun, 2026 | 15:16
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Apache CXF: No restriction on attachment headers per message

There is no restriction on the amount of attachment headers that a message can contain when being deserialized by Apache CXF, which can lead to uncontrolled resource consumption or a denial of service attack. Users are recommended to upgrade to versions 4.2.2 or 4.1.7, which fix this issue by imposing a maximum default of 500 attachments per message.

Action-Not Available
Vendor-The Apache Software Foundation
Product-Apache CXF
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2026-21720
Matching Score-4
Assigner-Grafana Labs
ShareView Details
Matching Score-4
Assigner-Grafana Labs
CVSS Score-7.5||HIGH
EPSS-0.04% / 11.14%
||
7 Day CHG~0.00%
Published-27 Jan, 2026 | 09:07
Updated-12 Jun, 2026 | 14:47
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Unauthenticated DoS: avatar cache leaks goroutines when /avatar/:hash requests time out

Every uncached /avatar/:hash request spawns a goroutine that refreshes the Gravatar image. If the refresh sits in the 10-slot worker queue longer than three seconds, the handler times out and stops listening for the result, so that goroutine blocks forever trying to send on an unbuffered channel. Sustained traffic with random hashes keeps tripping this timeout, so goroutine count grows linearly, eventually exhausting memory and causing Grafana to crash on some systems.

Action-Not Available
Vendor-Grafana Labs
Product-grafanagrafana/grafanagrafana/grafana-enterprise
CWE ID-CWE-400
Uncontrolled Resource Consumption
CWE ID-CWE-703
Improper Check or Handling of Exceptional Conditions
CVE-2026-21728
Matching Score-4
Assigner-Grafana Labs
ShareView Details
Matching Score-4
Assigner-Grafana Labs
CVSS Score-7.5||HIGH
EPSS-0.02% / 5.16%
||
7 Day CHG~0.00%
Published-24 Apr, 2026 | 08:00
Updated-12 Jun, 2026 | 14:47
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Tempo query limit results in unbounded memory allocation

Tempo queries with large limits can cause large memory allocations which can impact the availability of the service, depending on its deployment strategy. Mitigation can be done by setting max_result_limit in the search config, e.g. to 262144 (2^18).

Action-Not Available
Vendor-Grafana Labs
Product-Tempo
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2025-61772
Matching Score-4
Assigner-GitHub, Inc.
ShareView Details
Matching Score-4
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-0.32% / 55.80%
||
7 Day CHG~0.00%
Published-07 Oct, 2025 | 15:02
Updated-10 Oct, 2025 | 16:45
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Rack's multipart parser buffers unbounded per-part headers, enabling DoS (memory exhaustion)

Rack is a modular Ruby web server interface. In versions prior to 2.2.19, 3.1.17, and 3.2.2, `Rack::Multipart::Parser` can accumulate unbounded data when a multipart part’s header block never terminates with the required blank line (`CRLFCRLF`). The parser keeps appending incoming bytes to memory without a size cap, allowing a remote attacker to exhaust memory and cause a denial of service (DoS). Attackers can send incomplete multipart headers to trigger high memory use, leading to process termination (OOM) or severe slowdown. The effect scales with request size limits and concurrency. All applications handling multipart uploads may be affected. Versions 2.2.19, 3.1.17, and 3.2.2 cap per-part header size (e.g., 64 KiB). As a workaround, restrict maximum request sizes at the proxy or web server layer (e.g., Nginx `client_max_body_size`).

Action-Not Available
Vendor-rackrack
Product-rackrack
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2025-61919
Matching Score-4
Assigner-GitHub, Inc.
ShareView Details
Matching Score-4
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-0.28% / 51.90%
||
7 Day CHG~0.00%
Published-10 Oct, 2025 | 19:22
Updated-03 Nov, 2025 | 19:28
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Rack is vulnerable to a memory-exhaustion DoS through unbounded URL-encoded body parsing

Rack is a modular Ruby web server interface. Prior to versions 2.2.20, 3.1.18, and 3.2.3, `Rack::Request#POST` reads the entire request body into memory for `Content-Type: application/x-www-form-urlencoded`, calling `rack.input.read(nil)` without enforcing a length or cap. Large request bodies can therefore be buffered completely into process memory before parsing, leading to denial of service (DoS) through memory exhaustion. Users should upgrade to Rack version 2.2.20, 3.1.18, or 3.2.3, anu of which enforces form parameter limits using `query_parser.bytesize_limit`, preventing unbounded reads of `application/x-www-form-urlencoded` bodies. Additionally, enforce strict maximum body size at the proxy or web server layer (e.g., Nginx `client_max_body_size`, Apache `LimitRequestBody`).

Action-Not Available
Vendor-rackrack
Product-rackrack
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2025-61301
Matching Score-4
Assigner-MITRE Corporation
ShareView Details
Matching Score-4
Assigner-MITRE Corporation
CVSS Score-7.5||HIGH
EPSS-0.06% / 17.63%
||
7 Day CHG~0.00%
Published-20 Oct, 2025 | 00:00
Updated-21 Oct, 2025 | 19:31
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

Denial-of-analysis in reporting/mongodb.py and reporting/jsondump.py in CAPEv2 (commit 52e4b43, on 2025-05-17) allows attackers who can submit samples to cause incomplete or missing behavioral analysis reports by generating deeply nested or oversized behavior data that trigger MongoDB BSON limits or orjson recursion errors when the sample executes in the sandbox.

Action-Not Available
Vendor-n/a
Product-n/a
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2025-52293
Matching Score-4
Assigner-MITRE Corporation
ShareView Details
Matching Score-4
Assigner-MITRE Corporation
CVSS Score-7.5||HIGH
EPSS-0.04% / 12.34%
||
7 Day CHG~0.00%
Published-09 Jun, 2026 | 00:00
Updated-12 Jun, 2026 | 16:39
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

A segmentation violaton in the gf_hevc_read_sps_bs_internal function (media_tools/av_parsers.c) of GPAC MP4Box v2.4 allows attackers to cause a Denial of Service (DoS) via supplying crafted HEVC SPS data.

Action-Not Available
Vendor-n/aGPAC
Product-gpacn/a
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2025-61920
Matching Score-4
Assigner-GitHub, Inc.
ShareView Details
Matching Score-4
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-0.42% / 62.63%
||
7 Day CHG~0.00%
Published-10 Oct, 2025 | 19:25
Updated-03 Nov, 2025 | 18:17
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Authlib is vulnerable to Denial of Service via Oversized JOSE Segments

Authlib is a Python library which builds OAuth and OpenID Connect servers. Prior to version 1.6.5, Authlib’s JOSE implementation accepts unbounded JWS/JWT header and signature segments. A remote attacker can craft a token whose base64url‑encoded header or signature spans hundreds of megabytes. During verification, Authlib decodes and parses the full input before it is rejected, driving CPU and memory consumption to hostile levels and enabling denial of service. Version 1.6.5 patches the issue. Some temporary workarounds are available. Enforce input size limits before handing tokens to Authlib and/or use application-level throttling to reduce amplification risk.

Action-Not Available
Vendor-authlibauthlib
Product-authlibauthlib
CWE ID-CWE-20
Improper Input Validation
CWE ID-CWE-400
Uncontrolled Resource Consumption
CWE ID-CWE-770
Allocation of Resources Without Limits or Throttling
CVE-2026-44496
Matching Score-4
Assigner-GitHub, Inc.
ShareView Details
Matching Score-4
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-Not Assigned
Published-11 Jun, 2026 | 15:34
Updated-12 Jun, 2026 | 18:00
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Axios: Regular Expression Denial of Service (ReDoS) via Cookie Name Injection

Axios is a promise based HTTP client for the browser and Node.js. Axios versions before 0.32.0 on the 0.x line and before 1.16.0 on the 1.x line build a regular expression from the configured XSRF cookie name without escaping regex metacharacters. In standard browser environments, an attacker who can influence the cookie name passed to axios can cause expensive regex backtracking while axios reads document.cookie. The practical impact is client-side availability degradation, such as freezing the affected browser tab while axios prepares a request. The issue does not affect ordinary Node.js HTTP adapter usage, React Native, or web workers, where axios does not read document.cookie. This vulnerability is fixed in 0.32.0 and 1.16.0.

Action-Not Available
Vendor-axiosaxios
Product-axiosaxios
CWE ID-CWE-1333
Inefficient Regular Expression Complexity
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2025-61770
Matching Score-4
Assigner-GitHub, Inc.
ShareView Details
Matching Score-4
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-0.27% / 50.36%
||
7 Day CHG~0.00%
Published-07 Oct, 2025 | 14:30
Updated-10 Oct, 2025 | 16:44
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Rack's unbounded multipart preamble buffering enables DoS (memory exhaustion)

Rack is a modular Ruby web server interface. In versions prior to 2.2.19, 3.1.17, and 3.2.2, `Rack::Multipart::Parser` buffers the entire multipart preamble (bytes before the first boundary) in memory without any size limit. A client can send a large preamble followed by a valid boundary, causing significant memory use and potential process termination due to out-of-memory (OOM) conditions. Remote attackers can trigger large transient memory spikes by including a long preamble in multipart/form-data requests. The impact scales with allowed request sizes and concurrency, potentially causing worker crashes or severe slowdown due to garbage collection. Versions 2.2.19, 3.1.17, and 3.2.2 enforce a preamble size limit (e.g., 16 KiB) or discard preamble data entirely. Workarounds include limiting total request body size at the proxy or web server level and monitoring memory and set per-process limits to prevent OOM conditions.

Action-Not Available
Vendor-rackrack
Product-rackrack
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2021-33623
Matching Score-4
Assigner-MITRE Corporation
ShareView Details
Matching Score-4
Assigner-MITRE Corporation
CVSS Score-7.5||HIGH
EPSS-1.64% / 82.37%
||
7 Day CHG~0.00%
Published-28 May, 2021 | 00:00
Updated-03 Aug, 2024 | 23:58
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

The trim-newlines package before 3.0.1 and 4.x before 4.0.1 for Node.js has an issue related to regular expression denial-of-service (ReDoS) for the .end() method.

Action-Not Available
Vendor-trim-newlines_projectn/aNetApp, Inc.Debian GNU/Linux
Product-e-series_performance_analyzerdebian_linuxtrim-newlinesn/a
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2025-59439
Matching Score-4
Assigner-MITRE Corporation
ShareView Details
Matching Score-4
Assigner-MITRE Corporation
CVSS Score-7.5||HIGH
EPSS-0.04% / 13.52%
||
7 Day CHG+0.02%
Published-03 Feb, 2026 | 00:00
Updated-05 Feb, 2026 | 17:27
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

An issue was discovered in Samsung Mobile Processor, Wearable Processor and Modem Exynos 980, 990, 850, 1080, 9110, W920, W930, W1000 and Modem 5123. Incorrect handling of NAS Registration messages leads to a Denial of Service because of Improper Handling of Exceptional Conditions.

Action-Not Available
Vendor-n/aSamsung
Product-exynos_w1000exynos_980_firmwareexynos_w920_firmwareexynos_1080_firmwareexynos_990_firmwareexynos_modem_5123_firmwareexynos_980exynos_w930exynos_850_firmwareexynos_w920exynos_w930_firmwareexynos_9110_firmwareexynos_850exynos_9110exynos_w1000_firmwareexynos_modem_5123exynos_990exynos_1080n/a
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2025-59043
Matching Score-4
Assigner-GitHub, Inc.
ShareView Details
Matching Score-4
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-0.16% / 36.75%
||
7 Day CHG~0.00%
Published-17 Oct, 2025 | 16:03
Updated-24 Oct, 2025 | 17:13
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
OpenBao vulnerable to denial of service via malicious JSON request processing

OpenBao is an open source identity-based secrets management system. In OpenBao versions prior to 2.4.1, JSON objects after decoding may use significantly more memory than their serialized version. It is possible to craft a JSON payload to maximize the factor between serialized memory usage and deserialized memory usage, similar to a zip bomb, with factors reaching approximately 35. This can be used to circumvent the max_request_size configuration parameter which is intended to protect against denial of service attacks. The request body is parsed into a map very early in the request handling chain before authentication, which means an unauthenticated attacker can send a specifically crafted JSON object and cause an out-of-memory crash. Additionally, for requests with large numbers of strings, the audit subsystem can consume large quantities of CPU. The vulnerability is fixed in version 2.4.1.

Action-Not Available
Vendor-openbaoopenbao
Product-openbaoopenbao
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2023-49800
Matching Score-4
Assigner-GitHub, Inc.
ShareView Details
Matching Score-4
Assigner-GitHub, Inc.
CVSS Score-7.5||HIGH
EPSS-1.12% / 78.66%
||
7 Day CHG~0.00%
Published-08 Dec, 2023 | 23:41
Updated-02 Aug, 2024 | 22:01
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
Denial of service by abusing `fetchOptions.retry` in nuxt-api-party

`nuxt-api-party` is an open source module to proxy API requests. The library allows the user to send many options directly to `ofetch`. There is no filter on which options are available. We can abuse the retry logic to cause the server to crash from a stack overflow. fetchOptions are obtained directly from the request body. A malicious user can construct a URL known to not fetch successfully, then set the retry attempts to a high value, this will cause a stack overflow as ofetch error handling works recursively resulting in a denial of service. This issue has been addressed in version 0.22.1. Users are advised to upgrade. Users unable to upgrade should limit ofetch options.

Action-Not Available
Vendor-johannschopplichjohannschopplich
Product-nuxt_api_partynuxt-api-party
CWE ID-CWE-674
Uncontrolled Recursion
CWE ID-CWE-400
Uncontrolled Resource Consumption
CWE ID-CWE-787
Out-of-bounds Write
CVE-2025-5897
Matching Score-4
Assigner-VulDB
ShareView Details
Matching Score-4
Assigner-VulDB
CVSS Score-5.3||MEDIUM
EPSS-0.64% / 70.90%
||
7 Day CHG~0.00%
Published-09 Jun, 2025 | 21:00
Updated-10 Jul, 2025 | 16:28
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
vuejs vue-cli Markdown Code HtmlPwaPlugin.js HtmlPwaPlugin redos

A vulnerability was found in vuejs vue-cli up to 5.0.8. It has been rated as problematic. This issue affects the function HtmlPwaPlugin of the file packages/@vue/cli-plugin-pwa/lib/HtmlPwaPlugin.js of the component Markdown Code Handler. The manipulation leads to inefficient regular expression complexity. The attack may be initiated remotely.

Action-Not Available
Vendor-vuejsvuejs
Product-vue_clivue-cli
CWE ID-CWE-1333
Inefficient Regular Expression Complexity
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2025-5896
Matching Score-4
Assigner-VulDB
ShareView Details
Matching Score-4
Assigner-VulDB
CVSS Score-5.3||MEDIUM
EPSS-0.74% / 73.43%
||
7 Day CHG~0.00%
Published-09 Jun, 2025 | 20:31
Updated-10 Jul, 2025 | 16:27
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available
tarojs taro index.js redos

A vulnerability was found in tarojs taro up to 4.1.1. It has been declared as problematic. This vulnerability affects unknown code of the file taro/packages/css-to-react-native/src/index.js. The manipulation leads to inefficient regular expression complexity. The attack can be initiated remotely. Upgrading to version 4.1.2 is able to address this issue. The name of the patch is c2e321a8b6fc873427c466c69f41ed0b5e8814bf. It is recommended to upgrade the affected component.

Action-Not Available
Vendor-tarotarojs
Product-tarotaro
CWE ID-CWE-1333
Inefficient Regular Expression Complexity
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2022-1259
Matching Score-4
Assigner-Red Hat, Inc.
ShareView Details
Matching Score-4
Assigner-Red Hat, Inc.
CVSS Score-7.5||HIGH
EPSS-0.44% / 63.60%
||
7 Day CHG~0.00%
Published-31 Aug, 2022 | 00:00
Updated-02 Aug, 2024 | 23:55
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

A flaw was found in Undertow. A potential security issue in flow control handling by the browser over HTTP/2 may cause overhead or a denial of service in the server. This flaw exists because of an incomplete fix for CVE-2021-3629.

Action-Not Available
Vendor-n/aRed Hat, Inc.NetApp, Inc.
Product-single_sign-onintegration_camel_kopenshift_application_runtimesactive_iq_unified_managerundertowcloud_secure_agentoncommand_workflow_automationjboss_enterprise_application_platformbuild_of_quarkusoncommand_insightundertow
CWE ID-CWE-400
Uncontrolled Resource Consumption
CVE-2012-5366
Matching Score-4
Assigner-MITRE Corporation
ShareView Details
Matching Score-4
Assigner-MITRE Corporation
CVSS Score-7.5||HIGH
EPSS-0.94% / 76.69%
||
7 Day CHG~0.00%
Published-20 Feb, 2020 | 14:14
Updated-06 Aug, 2024 | 21:05
Rejected-Not Available
Known To Be Used In Ransomware Campaigns?-Not Available
KEV Added-Not Available
KEV Action Due Date-Not Available

The IPv6 implementation in Apple Mac OS X (unknown versions, year 2012 and earlier) allows remote attackers to cause a denial of service via a flood of ICMPv6 Router Advertisement packets containing multiple Routing entries.

Action-Not Available
Vendor-n/aApple Inc.
Product-mac_os_xn/a
CWE ID-CWE-400
Uncontrolled Resource Consumption
  • Previous
  • 1
  • 2
  • 3
  • ...
  • 26
  • 27
  • Next
Details not found